Recombinant Rickettsia typhi UPF0092 membrane protein RT0574 (RT0574)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yajC; RT0574; Sec translocon accessory complex subunit YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Target Names
yajC
Target Protein Sequence
MSQHTQDNQINNNETIEIQETDTVPIETNSLQSGLTSLIPMILIFAVFYFLLLRPQEQRR KEREKLVREVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDVRIKAIKSSIIDITSRK KEVAATQENNKKNKKVICAKSS
Uniprot No.

Target Background

Function

The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, membrane protein insertion, and the assembly of membrane protein complexes. While the SecYEG complex is crucial for the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex plays a vital role in facilitating these processes.

Database Links

KEGG: rty:RT0574

STRING: 257363.RT0574

Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Rickettsia typhi and what is the significance of RT0574 membrane protein?

Rickettsia typhi is the causative agent of endemic or murine typhus, a flea-borne infection maintained in an enzootic cycle involving rats, opossums, and other small mammals, along with their associated ectoparasites like fleas, mites, and lice. Human infection typically occurs when insect bites introduce flea feces into abraded skin, allowing infection of endothelial tissues .

The RT0574 protein (UPF0092 membrane protein) is a specific membrane protein encoded by the RT0574 gene in R. typhi. While not as extensively studied as the major immunodominant antigens like OmpB and LPS, membrane proteins like RT0574 are increasingly recognized for their potential roles in pathogenesis, immunological responses, and as targets for diagnostic and therapeutic development .

What is the molecular structure and characteristics of RT0574 protein?

The RT0574 protein (UPF0092 membrane protein) from Rickettsia typhi has the following molecular characteristics:

  • UniProt accession number: Q68WF3

  • Expression region: 1-142 amino acids

  • Complete amino acid sequence: MSQHTQDNQINNNETIEIQETDTVPIETNSLQSGLTSLIPMILIFAVFYFLLLRPQEQRRKEREKLVREVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDVRIKAIKSSIIDITSRKKEVAATQENNKKNKKVICAKSS

Based on the sequence analysis, RT0574 contains characteristic hydrophobic regions typical of membrane proteins, with predicted transmembrane domains that anchor it within the bacterial membrane. As a UPF0092 family protein, it belongs to a group of proteins with conserved sequence patterns but incompletely characterized functions across bacterial species.

How does recombinant RT0574 protein differ from native RT0574?

Recombinant RT0574 protein is produced through genetic engineering techniques rather than being purified from cultured R. typhi organisms. This distinction carries several important implications for research:

  • Post-translational modifications may differ between recombinant and native proteins, potentially affecting protein folding, function, and immunogenicity.

  • Expression systems (bacterial, insect, or mammalian) can influence protein characteristics. For example, bacterial expression systems like E. coli may not reproduce the same glycosylation patterns as the native protein .

  • The recombinant protein typically includes strategically designed tags for purification and detection purposes, which are absent in the native form.

  • Researchers must consider that proper methylation of recombinant antigens may be necessary to achieve sensitivity and specificity comparable to native proteins, as demonstrated with other R. typhi antigens .

What are the optimal conditions for expressing recombinant RT0574 protein?

The optimal expression of recombinant RT0574 protein involves several critical considerations:

Expression System Selection:

  • Bacterial systems (E. coli): Most commonly used for their simplicity and high yield, but may not reproduce post-translational modifications.

  • Insect cell systems: Better for membrane proteins requiring eukaryotic processing.

  • Mammalian cell systems: Optimal for proteins requiring complex folding or modifications but typically lower yield.

Expression Construct Design:

  • Include appropriate tags (His, GST, MBP) to facilitate purification while minimizing interference with protein folding.

  • Codon optimization for the selected expression system improves yield.

  • Consider using inducible promoters to control expression timing and reduce toxicity.

Cultivation Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins compared to standard 37°C.

  • Induction parameters: Optimize IPTG concentration and induction timing based on pilot experiments.

  • Media composition: Enriched media or supplementation with specific cofactors may enhance expression.

Similar methodologies to those used for other R. typhi proteins could be applied, such as PCR amplification of the coding sequence using specific primers, followed by cloning into appropriate expression vectors, as described for R. typhi OmpB .

What purification strategies are most effective for recombinant RT0574?

Effective purification of recombinant RT0574 membrane protein requires a multi-step approach to achieve high purity while maintaining protein integrity:

Initial Extraction:

  • For membrane proteins, detergent-based extraction is crucial - common detergents include n-dodecyl-β-D-maltoside (DDM), CHAPS, or Triton X-100.

  • Optimization of detergent type and concentration is essential to solubilize the protein without denaturing it.

Purification Methods:

  • Affinity Chromatography: Utilizing fusion tags (His, GST) for initial capture.

  • Size Exclusion Chromatography: For separating monomeric protein from aggregates.

  • Ion Exchange Chromatography: For removing contaminants with different charge properties.

Recommended Storage:

  • Store in Tris-based buffer with 50% glycerol at -20°C for routine use.

  • For extended storage, maintain at -80°C to prevent degradation.

  • Avoid repeated freeze-thaw cycles which can compromise protein integrity .

The purification protocol should be validated by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity.

How can researchers verify the structural integrity and functionality of purified RT0574?

Verifying the structural integrity and functionality of purified RT0574 requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: To evaluate secondary structure elements and confirm proper folding.

  • Thermal Shift Assays: To determine protein stability under various conditions.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): To confirm oligomeric state and homogeneity.

  • Limited Proteolysis: To probe accessibility of cleavage sites as an indicator of proper folding.

Functional Verification:

  • Binding Assays: Examine interactions with potential ligands or host cell components.

  • Immune Recognition: Assess reactivity with antibodies from R. typhi-infected patients.

  • Liposome Incorporation Assays: To evaluate membrane integration capabilities.

While specific functional assays for RT0574 are not extensively documented in the literature, researchers could adapt methods used for other R. typhi membrane proteins, focusing on their potential roles in bacterial-host interactions.

How can RT0574 be utilized in developing diagnostic assays for R. typhi infection?

RT0574 has potential applications in diagnostic assay development, though this requires understanding its context among other R. typhi antigens:

Existing Diagnostic Approaches:
Current R. typhi diagnostics primarily rely on two immunodominant antigens: lipopolysaccharide (LPS) and the outer membrane protein B (OmpB). IgG antibody detection shows that OmpB antigen alone detects 39% of positives, while LPS antigen alone detects 62%. Optimized mixtures of these antigens provide more comprehensive detection (100% in some studies) .

RT0574 Integration Strategies:

  • Multiplex Antigen Arrays: Incorporating RT0574 alongside established antigens (OmpB, LPS) to potentially improve sensitivity or specificity.

  • Recombinant Protein Microarrays: High-throughput screening to establish RT0574's diagnostic value.

  • ELISA Development: Similar to existing R. typhi ELISAs, but using RT0574 as the capture antigen.

Comparative Performance Analysis:
Researchers should conduct systematic comparisons of RT0574-based assays against gold standard diagnostics using well-characterized patient cohorts, measuring sensitivity, specificity, and cross-reactivity with related rickettsial species.

The potential value of RT0574 in diagnostics would need to be evaluated against established antigens, particularly given the high performance of optimized OmpB and LPS combinations currently used in ELISA formats .

What is the potential of RT0574 as a vaccine candidate against R. typhi infection?

Evaluating RT0574 as a vaccine candidate requires consideration of several immunological and practical factors:

Immunological Considerations:

  • Antigenicity: While major antigens like OmpB have demonstrated recognition by patient sera and vaccine potential , the immunogenicity of RT0574 specifically needs comprehensive evaluation.

  • Conservation: Sequence analysis across R. typhi strains would reveal conservation levels, which correlate with broad protective potential.

  • Accessibility: As a membrane protein, RT0574's exposure to the immune system during infection determines its suitability as a vaccine target.

Vaccine Development Approach:

  • Immunization Studies: Animal models (typically mice) should be immunized with purified RT0574 using appropriate adjuvants.

  • Challenge Experiments: Immunized animals would be challenged with virulent R. typhi to assess protection levels.

  • Immune Response Characterization: Measuring antibody titers, T-cell responses, and cytokine profiles to understand protective mechanisms.

Comparative Evaluation:
RT0574 should be evaluated alongside established vaccine candidates like OmpB. Research with other rickettsial species suggests that membrane proteins can indeed serve as effective vaccine components when properly formulated and delivered .

How can gene knockout or CRISPR-Cas9 techniques be applied to study RT0574 function?

Genetic manipulation studies provide powerful approaches to understanding RT0574 function through loss-of-function analyses:

Challenges in Rickettsial Genetic Manipulation:

  • Obligate intracellular lifestyle makes transformation difficult

  • Limited genetic tools compared to model organisms

  • Lower transformation efficiencies

Methodological Approaches:

  • Transformation Protocols for Rickettsia:

    • Electroporation with purified plasmid DNA

    • Optimization of field strength and buffer composition

    • Recovery in host cells (typically Vero or HeLa cells)

  • CRISPR-Cas9 Strategy:

    • Design of guide RNAs specific to RT0574 locus

    • Delivery of CRISPR components via specialized vectors

    • Homology-directed repair templates for marker insertion

  • Functional Analysis of Mutants:

    • Growth kinetics in cell culture

    • Microscopy to assess subcellular localization and cell morphology

    • Transcriptomics to identify compensatory pathways

    • In vivo infection studies in animal models

While specific protocols for RT0574 manipulation are not detailed in the provided search results, approaches similar to those used for other bacterial membrane proteins could be adapted, with appropriate modifications for rickettsial biology.

What roles might RT0574 play in R. typhi pathogenesis and host cell interactions?

Understanding RT0574's potential roles in pathogenesis requires consideration of its membrane localization and protein characteristics:

Potential Functional Roles:

  • Membrane Integrity: Many bacterial membrane proteins contribute to structural integrity and resistance to environmental stresses.

  • Transport Functions: The transmembrane domains suggest possible involvement in nutrient acquisition or waste export.

  • Host Cell Interactions: Surface-exposed regions could mediate adhesion to host cells or interactions with host immune components.

  • Immune Evasion: Some bacterial membrane proteins contribute to evasion of host defense mechanisms.

Research Approaches to Determine Function:

  • Protein-Protein Interaction Studies:

    • Pull-down assays with host cell lysates

    • Yeast two-hybrid screening against host protein libraries

    • Crosslinking experiments followed by mass spectrometry

  • Localization Studies:

    • Immunofluorescence microscopy with specific antibodies

    • Fractionation experiments to confirm membrane association

    • Protease accessibility assays to map surface-exposed domains

Without specific functional studies on RT0574 in the literature, these approaches would help elucidate its role in R. typhi biology and pathogenesis.

How does RT0574 compare with membrane proteins from other Rickettsia species?

Comparative analysis of RT0574 with homologs from other Rickettsia species provides evolutionary and functional insights:

Sequence Analysis:
A comprehensive bioinformatic analysis should include:

  • Multiple sequence alignment with homologs from related Rickettsia species (R. prowazekii, R. conorii, etc.)

  • Phylogenetic tree construction to understand evolutionary relationships

  • Identification of conserved domains and variable regions

Expression Patterns:
Examining differential expression of RT0574 homologs across:

  • Different Rickettsia species associated with varying disease presentations

  • Growth conditions mimicking different host environments

  • Various stages of infection cycle

Structure-Function Relationships:

  • Predicted structural features compared across species

  • Correlation of sequence variations with pathogenic differences

  • Identification of species-specific versus conserved functional regions

This comparative approach could reveal whether RT0574 contributes to the specific pathogenic profile of R. typhi compared to related rickettsial pathogens like R. prowazekii, which causes epidemic typhus .

What techniques can effectively distinguish between cross-reactive antibodies to R. typhi and R. prowazekii antigens?

Distinguishing between antibodies to R. typhi and R. prowazekii is crucial for accurate diagnosis, as these closely related pathogens cause endemic and epidemic typhus, respectively:

Current Differentiation Methods:
Cross-absorption protocols using recombinant antigens are employed to differentiate endemic (R. typhi) from epidemic typhus (R. prowazekii). These methods typically focus on the OmpB protein, with native methylation being crucial for sensitivity and specificity .

Recommended Methodological Approach:

  • Reciprocal Cross-Absorption Protocol:

    • Patient serum is divided into aliquots

    • Separate aliquots are absorbed with R. typhi and R. prowazekii antigens

    • Remaining reactivity is measured by ELISA or immunofluorescence assay

    • Differential reduction in antibody titers indicates the infecting species

  • Species-Specific Epitope Identification:

    • Peptide mapping to identify regions unique to each species

    • Development of assays targeting these differential epitopes

    • Validation using well-characterized patient cohorts

  • Molecular Confirmation:

    • PCR-based detection using species-specific primers

    • Nested PCR approaches targeting genes like prsA can provide definitive identification, as demonstrated in clinical samples

Data Analysis Considerations:
Interpretation of serological results should include:

  • Pre-absorption vs. post-absorption titer ratios

  • Statistical thresholds for significant reduction in titers

  • Controls to account for non-specific binding

What statistical approaches are most appropriate for analyzing RT0574-based diagnostic assay performance?

Rigorous statistical analysis is essential for validating RT0574-based diagnostics:

Key Performance Metrics:

  • Sensitivity: Proportion of true positives correctly identified

  • Specificity: Proportion of true negatives correctly identified

  • Positive Predictive Value (PPV): Probability that positive results are truly positive

  • Negative Predictive Value (NPV): Probability that negative results are truly negative

  • Receiver Operating Characteristic (ROC) curves: To determine optimal cutoff values

Recommended Statistical Methods:

Sample Size Considerations:
Power calculations should ensure sufficient sample sizes to detect clinically meaningful differences in diagnostic performance. For typical diagnostic studies, at least 50-100 confirmed positive cases and a similar number of negative controls are recommended for initial validation.

How can researchers optimize experimental workflows for membrane protein analysis in Rickettsia research?

Optimizing experimental workflows for rickettsial membrane proteins requires addressing several technical challenges:

Integrated Workflow Optimization:

  • Sample Preparation Enhancement:

    • Specialized cell lysis buffers containing detergent mixtures optimized for membrane protein extraction

    • Controlled sonication protocols to maintain protein integrity

    • Separation of inner and outer membrane fractions when relevant

  • Data Curation and Analysis:

    • Application of systematic curation approaches similar to those developed for membrane permeability data

    • Implementation of automated support tools to improve data consistency

    • KNIME workflow platform integration for visualizing analytical processes

  • Protocol Standardization:
    The following table outlines key parameters requiring standardization:

Experimental PhaseCritical ParametersOptimization Approach
Cell CultureGrowth media, passage number, harvest timingDesign of experiments (DoE) to identify optimal conditions
Protein ExtractionDetergent type, concentration, temperature, durationFactorial design testing multiple detergent combinations
PurificationColumn types, buffer composition, flow ratesSequential optimization of each purification step
Quality ControlPurity assessment methods, functional assaysMulti-method validation approach
  • Reproducibility Enhancement:

    • Development of standard operating procedures (SOPs)

    • Use of reference standards across laboratories

    • Implementation of automated protocols where possible

    • Detailed documentation of all experimental conditions

By systematically addressing these aspects, researchers can develop robust workflows for studying RT0574 and other Rickettsia membrane proteins, improving consistency and facilitating meaningful comparisons across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.