Recombinant Rinderpest virus Hemagglutinin glycoprotein (H)

Shipped with Ice Packs
In Stock

Description

Structure and Function

The H protein is a class 2 glycoprotein that facilitates the virus's attachment to the host cell receptor . The hemagglutinin protein of the measles virus (MV-H) binds to the receptor on a target cell, while the F protein facilitates membrane fusion between the virus envelope and the cell membrane .

Recombinant Expression

Recombinant DNA technology has enabled the production of the H protein in various expression systems.

  • Baculovirus Expression: A full-length cDNA encoding the H protein can be used to construct a recombinant baculovirus that expresses the H protein on the surface of insect cells . In this system, the small N-terminal cytoplasmic domain is deleted, and the transmembrane domain is replaced with a signal peptide from the baculovirus ecdysteroid UDP glycosyl transferase (egt) gene. This modification results in the secretion of the recombinant H protein (recH(sec)) into the medium, while another form, recH(M), is expressed on the cell surface .

  • Vaccinia Virus Expression: Recombinant vaccinia virus vaccines have been developed to express both the F and H genes of RPV . These vaccines, such as v2RVFH, induce high levels of F and H glycoprotein expression and extensive syncytium formation in infected cells .

Immunological Properties

The recombinant H protein retains reactivity with conformation-dependent monoclonal antibodies and is recognized by antibodies produced in cattle after vaccination or natural infection . Single administration of low doses of recombinant H protein expressed in insect cells can induce long-lasting bovine leukocyte antigen class I restricted cytotoxic T-cell (CTL) responses in cattle without needing an adjuvant . The soluble form of H protein is a valuable tool for studying the structure and function of the RPV H glycoprotein .

Immunodominant Neutralizing Epitopes

Research has identified several immunodominant neutralizing epitopes on the RPV-H protein . These epitopes are located at specific amino acid residues:

EpitopeAmino Acid Residue
A474
B243
D548 to 551
E587 to 592
G310 to 313
H383 to 387

These epitopes are positioned on the loop of the propeller-like structure in a hypothetical three-dimensional model of RPV-H .

Role in Host Range and Pathogenicity

The H protein plays an essential role in determining the host range of RPV . Studies involving recombinant viruses have shown that the H protein, along with other viral proteins such as the nucleocapsid (N) protein and phosphoprotein (P), contributes to the virus's pathogenicity in different species .

Vaccine Development

Recombinant H protein has shown promise as a vaccine candidate. For example, a recombinant capripoxvirus expressing the H protein gene of RPV has been shown to protect cattle against rinderpest . Additionally, incorporating the H and F genes into recombinant vaccinia virus vaccines has improved vaccine efficacy, inducing higher expression levels of these proteins and enhancing syncytium formation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
H; Hemagglutinin glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Rinderpest virus (strain L) (RDV)
Target Names
H
Target Protein Sequence
MSSPRDRVNAFYKDNLQFKNTRVVLNKEQLLIERPYMLLAVLFVMFLSLVGLLAIAGIRL HRAAVNTAEINSGLTTSIDITKSIEYQVKDVLTPLFKIIGDEVGLRTPQRFTDLTKFISD KIKFLNPDKEYDFRDINWCISPPERIKINYDQYCAHTAAEELITMLVNSSLAGTSVLPTS LVNLGRSCTGSTTTKGQFSNMSLALSGIYSGRGYNISSMITITEKGMYGSTYLVGKHNQG ARRPSTAWQRDYRVFEVGIIRELGLGTPVFHMTNYLELPRQPELEICMLALGEFKLAALC LADNSVALHYGGLRDDHKIRFVKLGVWPSPADSDTLATLSAVDPTLDGLYITTHRGIIAA GKAVWVVPVTRTDDQRKMGQCRREACREKPPPFCNSTDWEPLEAGRIPAYGILTIRLGLA DKLKLTIISEFGPLITHDSGMDLYTPLDGNEYWLTIPPLQNSALGTVNTLVLEPSLKISP NILTLPIRSGGGDCYTPTYLSDLADDDVKLSSNLVILPSRNLQYVSATYDTSRVEHAIVY YIYSAGRLSSYYYPVKLPIKGDPVSLQIGCFPWGLKLWCHHFCSVIDSGTRKQVTHTGAV GIEITCNSR
Uniprot No.

Target Background

Function
This protein mediates viral attachment to cellular receptors, initiating infection. H protein receptor binding induces a conformational change enabling F protein-mediated membrane fusion. It also downregulates human MCP/CD46 cell surface expression.
Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family, Non-sialidase subfamily
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host membrane; Single-pass type II membrane protein.

Q&A

Advanced Research Questions

  • What are the optimal conditions for expressing functional Rinderpest virus H protein in different systems?

    Optimal expression conditions vary by system:

    Baculovirus-Insect Cell System:

    • Optimal MOI (multiplicity of infection): 5-10 for high expression

    • Harvest time: 72 hours post-infection for optimal yield

    • Culture conditions: 27°C, pH 6.2-6.4

    • Benefits: The protein gets incorporated into extracellular baculovirus, forming a particulate antigen that enhances immunogenicity

    E. coli System:

    • Strain optimization: BL21(DE3) typically used

    • Induction conditions: 0.5-1.0 mM IPTG, 25-30°C for 4-6 hours

    • Tag selection: N-terminal His-tag for efficient purification

    • Limitations: Lacks glycosylation, may require refolding protocols

    Vaccinia Virus Vector System:

    • Promoter selection: Strong synthetic promoters increase expression by 3-4 fold compared to natural P7.5 promoters

    • Insertion site: Thymidine kinase (TK) gene preferred for stable expression

    • Co-expression: Combined expression with F protein enhances immunogenicity

    For functional studies requiring properly folded protein with biological activity, the baculovirus-insect cell system offers significant advantages, including preservation of conformational epitopes and enhanced immunogenicity .

  • How can the immunogenicity of recombinant Rinderpest virus H protein be enhanced for vaccine development?

    Several strategies have proven effective for enhancing immunogenicity:

    1. Co-expression with F protein: Combining H and F proteins provides superior protection compared to either protein alone, with evidence of sterilizing immunity (no anamnestic response upon challenge)

    2. Optimized expression vectors: Using strong synthetic promoters can increase expression levels 3-4 fold, enhancing immunogenicity. Vaccinia virus vectors with the Copenhagen strain background have shown excellent safety and efficacy profiles

    3. Particulate antigen formation: Expressing H protein in a form that creates virus-like structures or incorporates into extracellular virus particles enhances immunogenicity by:

      • Presenting antigens in a multivalent format

      • Improving antigen uptake by antigen-presenting cells

      • Stimulating both humoral and cell-mediated immunity

    4. Low-dose effectiveness: Remarkably, single administration of low doses (108 PFU) of recombinant vaccinia virus expressing both F and H genes provides long-term sterilizing immunity, suggesting that optimized presentation may be more important than high antigen loads

    These approaches have demonstrated protection with doses as low as 103 PFU for vaccinia-vectored H+F vaccines, highlighting the efficiency of these enhancement strategies .

  • What methodologies are most effective for analyzing T-cell responses to recombinant Rinderpest virus H protein?

    Several complementary techniques have been employed to analyze T-cell responses:

    1. Lymphoproliferation assays: Peripheral blood mononuclear cells (PBMCs) from immunized cattle are cultured with recombinant H protein or peptides, and proliferation is measured by [3H]-thymidine incorporation. This approach identified:

      • BoLA class II restricted helper T cell responses

      • T-helper epitope regions (aa 123-137 and 575-583)

    2. Epitope mapping strategies:

      • Expression of truncated H protein fragments in E. coli

      • Synthetic overlapping peptides covering regions of interest

      • Cross-reactive peptides from measles virus H protein

    3. CTL assays: Cytotoxic T-lymphocyte responses are measured using:

      • 51Cr-release assays with effector and target cells

      • Flow cytometry-based killing assays

      • These assays revealed BoLA class I restricted CTL responses to recombinant H protein

    4. In vivo assessment: Challenge studies in vaccinated animals with monitoring of:

      • Clinical protection

      • Absence of anamnestic responses (indicating sterilizing immunity)

      • Prevention of virus shedding

    These methodologies have been crucial for understanding the comprehensive immune responses induced by recombinant H protein and for identifying key epitopes for vaccine development.

  • How do post-translational modifications affect the antigenicity and functionality of recombinant Rinderpest virus H protein?

    Post-translational modifications significantly impact H protein functionality:

    1. Glycosylation patterns:

      • Native H protein contains N-linked glycans that influence:

        • Protein folding and stability

        • Receptor binding efficiency

        • Antigenicity and immunogenicity

      • Expression systems differ in glycosylation capabilities:

        • Insect cells provide partial glycosylation (high mannose type)

        • E. coli lacks glycosylation machinery entirely

        • Mammalian cells provide glycosylation closest to native virus

    2. Functional implications:

      • H proteins expressed in insect cells retain receptor binding functionality, indicating that insect cell glycosylation is sufficient for maintaining key antigenic properties

      • H proteins expressed in E. coli are useful for epitope mapping but may lack conformational epitopes dependent on glycosylation

    3. Immunological consequences:

      • H protein expressed in insect cells induces stronger immune responses compared to bacterially expressed protein

      • The particulate nature of H protein incorporated into extracellular baculovirus enhances immunogenicity, partially compensating for differences in glycosylation

    For vaccine development, expression systems that provide appropriate post-translational modifications are preferred to ensure proper folding, antigenicity, and functionality of the recombinant H protein.

  • What are the challenges in developing DIVA (Differentiating Infected from Vaccinated Animals) strategies using recombinant Rinderpest virus H protein?

    DIVA strategies are critical for disease eradication programs. Several approaches using recombinant H protein offer potential solutions:

    1. Recombinant vaccinia virus vaccines expressing F and H:

      • Allow serological differentiation between vaccinated and naturally infected animals

      • Vaccinated animals develop antibodies only to F and H proteins

      • Naturally infected animals develop antibodies to all viral proteins

      • Companion diagnostic tests can detect antibodies to non-structural proteins

    2. Epitope deletion/modification approaches:

      • Strategic modification of non-essential epitopes in recombinant H

      • Development of tests detecting antibodies to deleted/modified epitopes

      • Challenge: Maintaining immunogenicity while modifying epitopes

    3. Chimeric H proteins:

      • Incorporation of foreign epitope tags into the H protein structure

      • Animals vaccinated with chimeric H develop antibodies to the tag

      • Companion diagnostics detect tag-specific antibodies

      • An example is the successful incorporation of GFP fusion proteins or influenza hemagglutinin epitopes into recombinant RPV

    4. Implementation challenges:

      • Validating companion diagnostic tests in field conditions

      • Ensuring equivalent protection compared to conventional vaccines

      • Regulatory approval for genetically modified vaccines

      • Training of field personnel in test interpretation

    The recombinant vaccinia virus expressing both F and H genes (v2RVFH) has shown particular promise, as it provides sterilizing immunity while allowing for serological differentiation, making it a candidate for rinderpest eradication programs .

  • How can recombinant Rinderpest virus H protein be used to develop cross-protective vaccines against related morbilliviruses?

    The potential for cross-protection stems from structural and antigenic similarities among morbillivirus H proteins:

    1. Conserved T-helper epitopes:

      • The region around aa 123-137 in RPV H is conserved with measles virus and other morbilliviruses

      • This conservation suggests potential for cross-reactive T-cell responses

    2. Experimental approaches for cross-protective vaccines:

      • Chimeric H proteins incorporating conserved epitopes from multiple morbilliviruses

      • Focus on conserved regions while maintaining species-specific neutralizing epitopes

      • Evaluation of cross-neutralization by sera from animals immunized with recombinant H

    3. Potential applications:

      • Protection against Peste-des-petits-ruminants virus (PPRV) in small ruminants

      • A recombinant Bovine Herpesvirus-4 vector expressing PPRV H has shown promise in mice, suggesting a similar approach could work for RPV H

      • Combined vaccines protecting against multiple morbilliviruses

    4. Challenges to address:

      • Balancing breadth and potency of immune responses

      • Ensuring protection against emerging variants

      • Validating cross-protection in relevant animal models

    The high homology between regions of RPV H and other morbillivirus H proteins provides a scientific foundation for developing vaccines with broader protection, potentially addressing multiple morbillivirus threats with a single vaccine formulation.

  • What are the most effective techniques for purifying recombinant Rinderpest virus H protein while preserving its immunogenicity?

    Purification strategies must balance yield with preservation of conformational epitopes:

    1. For His-tagged H protein expressed in E. coli:

      • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins

      • Inclusion body solubilization using 8M urea followed by on-column refolding

      • Size exclusion chromatography for final polishing

      • Challenge: Recovering properly folded protein from inclusion bodies

    2. For H protein expressed in insect cells:

      • Purification of extracellular virus containing H protein by:

        • Ultracentrifugation through sucrose cushions

        • Gradient purification to isolate intact viral particles

      • Advantages: Preserves native conformation and particulate structure

      • This approach showed superior immunogenicity in cattle studies

    3. For vaccinia virus-expressed H protein:

      • Direct immunization with recombinant virus

      • Purification generally not required as the vaccine is used as live recombinant virus

      • Demonstrated excellent efficacy with doses as low as 103 PFU

    4. Quality control parameters:

      • Functional assessment through hemagglutination assays

      • Confirmation of antigenic integrity via ELISA with conformation-dependent monoclonal antibodies

      • SDS-PAGE and Western blot analysis for purity and identity

    For vaccine applications, maintaining the particulate nature of the antigen (either as recombinant virus or virus-like particles) has proven more effective than purified monomeric protein, highlighting the importance of structural presentation for optimal immunogenicity.

  • How do mutations in the Rinderpest virus H protein affect receptor binding and cell fusion activities?

    Structure-function relationships in the H protein are critical for viral fitness:

    1. Receptor binding domains:

      • Key regions involved in receptor binding include the beta-sheet propeller structure

      • Mutations in these regions can alter:

        • Host range and tissue tropism

        • Binding affinity to cellular receptors

        • Potential for cross-species transmission

    2. Interaction with F protein:

      • H protein binding to cellular receptors triggers conformational changes

      • These changes activate the F protein, initiating membrane fusion

      • Mutations affecting H-F interactions can impair fusion activity

      • Evidence: Extensive syncytium formation observed with co-expression of F and H proteins under strong promoters

    3. Experimental observations:

      • Recombinant vaccinia virus expressing both F and H (v2RVFH) forms large syncytia containing hundreds of nuclei

      • This extensive fusion activity correlates with enhanced immunogenicity

      • In contrast, lower expression levels result in smaller syncytia with fewer nuclei

    4. Functional implications for vaccine design:

      • Optimizing expression levels of both H and F proteins enhances fusion activity

      • Strong synthetic promoters increase expression 3-4 fold over natural promoters

      • Enhanced syncytium formation may contribute to improved immunogenicity by increasing antigen presentation and spreading

    Understanding these structure-function relationships is crucial for designing optimized vaccine antigens and for predicting the impact of naturally occurring mutations on viral pathogenicity and host range.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.