Recombinant RING finger protein 121 (rnf-121)

Shipped with Ice Packs
In Stock

Description

Ubiquitination and Protein Degradation

  • NaV channel regulation: RNF121 mediates ubiquitin-dependent degradation of misfolded voltage-gated sodium channels while promoting membrane localization of properly folded channels via β-subunit interactions .

  • MYCN stabilization: In neuroblastoma, RNF121 forms a complex with MYCN proto-oncogene, enhancing its stability and oncogenic activity .

Apoptosis Regulation

  • Pro-survival role: RNF121 knockdown induces caspase-3 activation and PARP cleavage, triggering apoptosis in cancer cells .

  • Chemoresistance modulation: RNF121 depletion sensitizes cells to etoposide-induced apoptosis .

Cancer Biology

  • Neuroblastoma: High RNF121 expression correlates with poor prognosis in MYCN-amplified tumors. Knockdown reduces cell viability by 40–60% in SK-N-BE(2)-C and Kelly cell lines .

  • Breast cancer: RNF121 regulates apoptosis pathways and cellular niches, influencing tumor progression .

Viral Vector Engineering

  • AAV genome transcription: RNF121 knockout reduces adeno-associated virus (AAV) transgene expression by 70–90%, implicating it in transcriptional regulation .

Table 2: Key Findings in Cancer Research

Study ModelInterventionOutcomeSource
NeuroblastomaRNF121 siRNA↓ Cell viability, ↓ MYCN stability
HEK293T cellsRNF121 + NaV1.6↑ Ubiquitination, ↑ surface trafficking
Breast cancerRNF121 knockdown↑ Apoptosis with etoposide

Clinical Implications

  • Prognostic biomarker: Elevated RNF121 mRNA levels predict poor survival in neuroblastoma and laryngeal cancer .

  • Therapeutic target: Targeting RNF121’s transmembrane helix 5 disrupts MYCN-driven oncogenesis .

Challenges and Future Directions

  • Dual functionality: RNF121 exhibits paradoxical roles in protein degradation (e.g., NaV channels) and stabilization (e.g., MYCN), complicating therapeutic strategies .

  • Substrate specificity: Only three substrates (β-integrin, VEGFR2, NaV) are confirmed; broader interactome studies are needed .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
rnf-121; C16C10.5; RING finger protein 121
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
rnf-121
Target Protein Sequence
MTFSYFISIFTANLSPTFPCRKVNQLNYFYQLLNLKCFFRSIFKIGHFPRGSPLYLLEKS ITFSKIISIFSGHRMGQHGAIRLQNEVQEGMPPPHELTEEEQWAEEHRKMHEKHKGHEAM HMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTLIGMLTIPVYVCFNRSWYRFLATWLV FCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKLSYVLGVVGYLIMMGALLGFHVLFGV SQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMASRIGYYTPEGLPKKHLEDGVCAVCG GRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGHVFHEFCIRGWVVVGKLQTCPYCKER VDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLIVTAVQGLTTWMGLE
Uniprot No.

Target Background

Function
Essential for the termination of distal tip cell migration during the final stages of larval morphogenesis.
Database Links
Protein Families
RNF121 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RING finger protein 121 and what are its primary cellular functions?

RING finger protein 121 (RNF121) is an E3 ubiquitin ligase that localizes primarily to the endoplasmic reticulum (ER) and cis-Golgi compartments. Its primary functions include:

  • Regulation of protein quality control through ubiquitin-mediated proteasomal degradation

  • Facilitation of membrane localization of certain proteins, particularly voltage-gated sodium channels

  • Regulation of adeno-associated virus (AAV) genome transcription

  • Involvement in MYCN stabilization in certain cancer types

RNF121 contains multiple transmembrane domains and a catalytic RING finger domain that is essential for its ubiquitin ligase activity. It serves as a critical mediator in cellular protein homeostasis by targeting misfolded proteins for degradation while facilitating the transport of properly folded proteins to appropriate cellular compartments .

How is RNF121 structurally organized and what domains are critical for its function?

RNF121 consists of 327 amino acids organized into specific functional domains:

  • N-terminal RING finger domain: Essential for E3 ubiquitin ligase activity

  • Multiple transmembrane segments: Critical for anchoring in the ER and Golgi membranes

  • Transmembrane Helix 4: Contains the M158 residue that when mutated (M158R) affects protein stability and Golgi localization

  • Transmembrane Helix 5: Particularly important for RNF121's enhancement of MYCN-amplified neuroblastoma cell growth

The catalytic domain of the E3 ligase is essential for most of RNF121's cellular functions. Mutations that affect the transmembrane domains, particularly in Helix 4, can significantly reduce protein stability and prevent proper Golgi localization, effectively ablating its function . The integrity of these domains is crucial for RNF121's ability to regulate protein degradation and trafficking pathways.

What methodologies are recommended for detecting endogenous versus recombinant RNF121 expression?

For optimal detection of RNF121 expression:

Endogenous RNF121 detection:

  • Quantitative RT-PCR: Use primers targeting conserved regions of RNF121 mRNA, normalizing to housekeeping genes like GAPDH

  • Western blotting: Use commercially available antibodies against RNF121 with appropriate positive controls

  • Immunofluorescence: Co-staining with protein disulfide isomerase as a marker for ER and cis-Golgi compartments

Recombinant RNF121 detection:

  • Western blotting: When expressing tagged RNF121, include proteasome inhibitors like MG132 to prevent potential degradation

  • Fluorescence microscopy: For GFP-tagged RNF121, co-localization studies with ER/Golgi markers are recommended

  • Quantitative analysis: Use flow cytometry for large-scale assessment of expression levels

HEK293T cells, which lack endogenous expression of RNF121, provide an excellent negative control and expression system for recombinant studies . When performing these assays, it's critical to include appropriate controls to distinguish between endogenous and recombinant protein expression.

How does RNF121 knockout affect adeno-associated virus (AAV) transduction efficiency?

CRISPR-mediated knockout of RNF121 produces profound effects on AAV transduction:

  • Marked decrease in AAV transduction regardless of capsid serotype or vector dose

  • Near ablation of AAV transgene expression in RNF121 knockout cells

  • Reduction in transgene-derived mRNA levels by over two orders of magnitude compared to control cells

  • Similar effects observed across different cell lines

Importantly, this effect is specific to AAV, as Adenovirus transduction remains unaffected in RNF121 knockout cells. The inhibition occurs at the level of transcription rather than at earlier steps in the infectious pathway, as RNF121 is dispensable for AAV cellular uptake, nuclear entry, and uncoating .

This research highlights RNF121 as a critical host factor for AAV-mediated gene delivery, with significant implications for gene therapy applications using AAV vectors.

What mechanisms underlie RNF121's regulation of AAV genome transcription?

The regulation of AAV genome transcription by RNF121 involves complex molecular pathways:

  • Transcriptional arrest prevention: RNF121 prevents transcriptional arrest of AAV genomes through a mechanism involving DNA-PKCs, VCP/p97, and DNA damage machinery

  • RNA Polymerase recruitment: ChIP assays indicate that RNF121 influences RNA Polymerase recruitment or progression along AAV genomes

  • VCP/p97 pathway involvement: Inhibition of Valosin Containing Protein (VCP/p97), which targets substrates to the proteasome, can restore AAV-mediated transgene expression in RNF121 knockout cells

  • DNA damage response: Transcriptomic and proteomic analyses show that the catalytic subunit of DNA PK (DNAPK-Cs) is upregulated in RNF121 knockout cells, with DNA damage machinery enriched at sites of stalled AAV genome transcription

The connection between RNF121, VCP/p97, and DNA damage response elements forms a regulatory network that influences transcriptional silencing and/or activation of AAV vector genomes . This mechanistic understanding is crucial for optimizing AAV vector design and improving gene therapy outcomes.

Can co-infection with helper viruses rescue AAV transduction in RNF121-deficient cells?

Despite the well-established role of Adenovirus as a helper virus for AAV replication, experimental data shows that:

  • Co-infection of wild-type human adenovirus 5 with AAV2 luciferase does not fully restore AAV transduction in RNF121 knockout cells

  • Adenovirus significantly enhances transduction in control cells but fails to compensate for RNF121 deficiency

  • Recombinant AAV transduction can be partially rescued by overexpressing RNF121, but not by co-infection with helper Adenovirus

This suggests that RNF121's role in AAV genome transcription represents a distinct pathway that cannot be complemented by adenoviral helper functions. The helper virus genes that typically enhance AAV transduction through more efficient endosomal trafficking and transcriptional activation are insufficient to overcome the transcriptional block caused by RNF121 deficiency .

These findings indicate that RNF121 performs a unique and essential function in AAV biology that operates independently of the classical helper virus pathways.

How does RNF121 influence voltage-gated sodium channel (Nav) membrane localization?

RNF121 exhibits two seemingly paradoxical effects on voltage-gated sodium channels:

Dual regulatory mechanisms:

  • Quality control function: RNF121 facilitates ubiquitination of misfolded Nav proteins, marking them for proteasome-mediated degradation

  • Transport facilitation: When co-expressed with auxiliary Navβ subunits, RNF121 enhances membrane localization of properly folded Nav channels

Experimental evidence:

This suggests a model where constitutive clearance of Nav channels (whether properly folded or misfolded) is necessary for efficient transport of functional channels to the membrane. Without this quality control step mediated by RNF121, misfolded Nav proteins accumulate in the ER and cis-Golgi, sequestering available Navβ subunits and impeding transport of even properly folded channels .

What experimental approaches can distinguish between RNF121's degradation versus membrane localization functions?

To differentiate between RNF121's dual functions:

For degradation function assessment:

  • Ubiquitination assays: Immunoprecipitate Nav channels and probe for ubiquitin to measure RNF121-mediated ubiquitination

  • Proteasome inhibition: Treat cells with MG132 and measure Nav protein levels with/without RNF121 co-expression

  • Mutant analysis: Compare wild-type RNF121 with catalytically inactive mutants (e.g., RNF121 V228A)

For membrane localization assessment:

  • Surface biotinylation: Label surface proteins with biotin, pull down with streptavidin, and quantify Nav channels

  • Electrophysiology: Measure sodium currents to assess functional Nav channels at the membrane

  • Co-expression studies: Evaluate the effect of Navβ subunit co-expression on Nav localization

Comparative experimental design:

  • Express Nav1.6 alone

  • Co-express Nav1.6 with RNF121

  • Co-express Nav1.6 with RNF121 and Navβ1

  • Include proteasome inhibition conditions

In zebrafish models, touch response assays provide a functional readout for Nav channel activity, with RNF121 morpholino knockdown showing dose-dependent effects on touch responsiveness .

What is the proposed cellular model for Nav channel regulation in the absence of RNF121?

Based on experimental findings, the following model explains Nav channel regulation when RNF121 is absent:

  • Accumulation of misfolded proteins: Without RNF121's quality control function, misfolded Nav proteins accumulate in the ER and cis-Golgi compartments

  • Sequestration of auxiliary subunits: These accumulated misfolded Nav proteins sequester available Navβ subunits

  • Transport impairment: The shortage of Navβ subunits in the Golgi impedes the transport of even properly folded Nav proteins

  • Functional consequences: This leads to diminished Nav channel activity in excitable cells and corresponding physiological deficits (e.g., touch unresponsiveness in zebrafish)

This model explains the observation that overexpression of Navβ1 in RNF121-deficient zebrafish (alligator mutants) can restore some transport of Nav channels to the membrane in Rohon-Beard neurons but fails to completely restore touch responsiveness. The partial rescue suggests that the amount of Nav channel transported remains insufficient to restore activity throughout the sensorimotor circuit .

What is the relationship between RNF121 and MYCN in neuroblastoma pathogenesis?

RNF121 plays a critical role in MYCN-driven neuroblastoma through several mechanisms:

  • Direct binding: RNF121 wild type (RNF121^WT) directly binds to MYCN protein

  • MYCN stabilization: RNF121^WT enhances MYCN protein stability

  • Expression correlation: RNF121 expression markedly increases during TH-MYCN tumorigenesis

  • Genetic evidence: Hemizygous RNF121 gene deletion reduces TH-MYCN tumorigenicity

  • Structural requirements: RNF121^WT-enhanced growth of MYCN-amplified neuroblastoma cells depends specifically on RNF121^WT transmembrane Helix 5

A critical mutation in Helix 4 of RNF121's transmembrane domain (M158R) causes reduced protein stability and absent Golgi localization, associated with heritable loss of tumorigenicity in neuroblastoma-prone mice. This indicates that proper subcellular localization of RNF121 is essential for its oncogenic function .

The relationship between RNF121 and MYCN establishes RNF121 as an essential oncogenic cofactor for MYCN-driven neuroblastoma, suggesting potential for therapeutic targeting.

How does RNF121 expression correlate with clinical outcomes in cancer patients?

Clinical data analysis reveals significant correlations between RNF121 expression and patient outcomes:

  • High RNF121 mRNA expression associates with poor prognosis in human neuroblastoma tissues

  • Similar poor prognostic association is observed in another MYC-driven malignancy, laryngeal cancer

  • The prognostic significance appears particularly strong in cancers with MYC family oncogene dysregulation

These clinical correlations support the functional studies indicating RNF121's role as an oncogenic cofactor, particularly in MYC-driven malignancies. The consistent association between elevated RNF121 expression and poor clinical outcomes across different cancer types suggests a conserved oncogenic mechanism .

This clinical data provides rationale for investigating RNF121 as both a prognostic biomarker and potential therapeutic target in MYC-driven cancers.

What experimental models are most effective for studying RNF121's role in cancer?

Several complementary experimental models have proven valuable for investigating RNF121 in cancer:

In vivo models:

  • Transgenic TH-MYCN mice: The neuroblastoma-prone TH-MYCN transgenic mouse model with ENU mutagenesis has revealed RNF121's essential role in MYCN-driven tumorigenesis

  • RNF121 gene deletion models: Hemizygous RNF121 knockout mice show reduced tumorigenicity

  • Zebrafish models: Although primarily used for studying RNF121's role in neuronal function, zebrafish models can provide insights into developmental aspects relevant to cancer

In vitro models:

  • MYCN-amplified neuroblastoma cell lines: Ideal for studying RNF121-MYCN interactions

  • CRISPR/Cas9 gene editing: Generation of RNF121 knockout cell lines for mechanistic studies

  • Structure-function analysis: Expression of RNF121 mutants (e.g., M158R) to dissect domain-specific functions

Methodological approaches:

  • Protein-protein interaction studies: Co-immunoprecipitation and proximity ligation assays to study RNF121-MYCN binding

  • Protein stability assays: Cycloheximide chase experiments to assess MYCN half-life in the presence/absence of RNF121

  • Subcellular localization: Immunofluorescence microscopy to track RNF121 localization to the Golgi complex

The combined use of these models and approaches has established RNF121 as an oncogenic cofactor and potential therapeutic target in MYCN-driven cancers .

What are the recommended methods for creating and validating RNF121 knockout cell lines?

For effective creation and validation of RNF121 knockout cell lines:

Generation methods:

  • CRISPR-Cas9 approach:

    • Design guide RNAs targeting early exons of RNF121

    • Use multiple guide RNAs to increase knockout efficiency

    • Create single-cell clones for homogeneous populations

  • Alternative approaches:

    • RNAi for temporary knockdown (useful for initial screening)

    • Antisense morpholino oligonucleotides (for zebrafish models)

Validation techniques:

  • Genomic validation:

    • PCR and sequencing of the targeted locus

    • Restriction fragment length polymorphism (RFLP) analysis

  • Expression validation:

    • Western blotting to confirm absence of RNF121 protein

    • qRT-PCR to assess RNF121 mRNA levels

  • Functional validation:

    • AAV transduction assays (expect significantly reduced transduction)

    • Analysis of Nav channel membrane localization

    • Assessment of ubiquitination levels of known substrates

  • Rescue experiments:

    • Reintroduction of wild-type RNF121 should restore function

    • Mutant forms (e.g., V228A) should fail to rescue

When creating knockout lines, it's important to generate and characterize multiple clones to control for off-target effects and clonal variations. Non-targeting control cells should undergo the same selection process to serve as appropriate controls .

What assays can measure RNF121's E3 ubiquitin ligase activity and identify its substrates?

To assess RNF121's E3 ligase activity and identify substrates:

E3 ligase activity assays:

  • In vitro ubiquitination:

    • Purified components (E1, E2, RNF121, ubiquitin, ATP)

    • Detection of polyubiquitin chains by Western blot

    • Comparison between wild-type RNF121 and catalytically inactive mutants

  • Cell-based ubiquitination:

    • Co-expression of RNF121 and potential substrates

    • Treatment with proteasome inhibitors (e.g., MG132)

    • Immunoprecipitation of substrate followed by ubiquitin detection

Substrate identification approaches:

  • Candidate approach:

    • Co-immunoprecipitation of RNF121 with potential substrates

    • Assessment of substrate levels in RNF121 knockout vs. control cells

    • Protein stability assays (cycloheximide chase)

  • Unbiased screening:

    • Ubiquitin remnant profiling by mass spectrometry

    • Comparative proteomics between RNF121 knockout and control cells

    • Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

  • Validation experiments:

    • Reconstitution assays with purified components

    • Mutational analysis of predicted ubiquitination sites on substrates

    • In vivo confirmation using model organisms

For Nav channel studies, experiments have shown that while Nav1.6 channels are regulated by RNF121, they may not be direct substrates for ubiquitination. Treatment with MG132 restores Nav1.6 protein levels and increases ubiquitination, suggesting an indirect regulatory mechanism .

How can researchers effectively study RNF121's subcellular localization and trafficking?

For comprehensive analysis of RNF121 localization and trafficking:

Localization studies:

  • Immunofluorescence microscopy:

    • Co-staining with organelle markers: protein disulfide isomerase for ER/cis-Golgi, GM130 for Golgi

    • Super-resolution microscopy for detailed subcellular distribution

    • Live-cell imaging with fluorescently tagged RNF121

  • Biochemical fractionation:

    • Differential centrifugation to isolate cellular compartments

    • Density gradient separation of organelles

    • Western blotting of fractions for RNF121 and compartment markers

Trafficking dynamics:

  • Fluorescence recovery after photobleaching (FRAP):

    • Measure mobility and exchange rates between compartments

    • Compare wild-type vs. mutant RNF121 (e.g., M158R)

  • Photoactivatable or photoconvertible fusion proteins:

    • Track movement of specific protein populations over time

    • Determine directionality of trafficking

  • Trafficking perturbation:

    • Brefeldin A treatment to disrupt ER-Golgi trafficking

    • Temperature blocks to synchronize protein trafficking

    • Dominant-negative Rab or ARF GTPase expression

Mutational analysis:

  • Compare localization of wild-type RNF121 vs. transmembrane domain mutants

  • Determine which domains are essential for proper localization

The M158R mutation in Helix 4 of RNF121's transmembrane domain causes absent Golgi localization, highlighting the importance of this region for proper subcellular targeting. In contrast, wild-type RNF121 localizes predominantly to the cis-Golgi Complex, which is critical for its function in protein quality control .

How does RNF121 integrate with the DNA damage response machinery to regulate AAV genome transcription?

The intersection between RNF121 and DNA damage response (DDR) in AAV transcription regulation involves complex interactions:

Molecular connections:

  • Transcriptomic and proteomic analyses reveal upregulation of DNAPK-Cs (the catalytic subunit of DNA PK) in RNF121 knockout cells

  • DNA damage machinery is enriched at sites of stalled AAV genome transcription in the absence of RNF121

  • VCP/p97, which is targeted by DNAPK-Cs, appears to be a key mediator in this pathway

Proposed regulatory network:

  • RNF121 normally prevents excessive DDR activation at AAV genomes

  • Without RNF121, DNAPK-Cs activates VCP/p97

  • Activated VCP/p97 contributes to transcriptional arrest of AAV genomes

  • Inhibition of VCP/p97 can restore AAV-mediated transgene expression in RNF121 knockout cells

This network suggests that RNF121 functions to protect AAV genomes from being recognized as DNA damage or silenced by cellular defense mechanisms. The DDR machinery may inappropriately target AAV genomes in the absence of RNF121, leading to transcriptional arrest .

Understanding this relationship could lead to strategies for enhancing AAV gene therapy by modulating DDR pathways.

What is the structural basis for RNF121's interaction with MYCN and how might this be therapeutically targeted?

The structural interaction between RNF121 and MYCN presents opportunities for therapeutic intervention:

Structural determinants:

  • RNF121 directly binds to MYCN protein, enhancing its stability

  • Transmembrane Helix 5 of RNF121 is particularly important for RNF121's enhancement of MYCN-amplified neuroblastoma cell growth

  • The RING finger domain likely plays a role in the functional consequences of this interaction

Potential therapeutic approaches:

  • Small molecule inhibitors:

    • Target the RNF121-MYCN binding interface

    • Disrupt RNF121's stabilizing effect on MYCN

  • Peptide-based approaches:

    • Develop peptides mimicking key interaction regions

    • Use cell-penetrating peptides to deliver inhibitory sequences

  • Indirect targeting:

    • Modulate RNF121 localization to the Golgi

    • Target upstream regulators of RNF121 expression

  • Degradation-inducing strategies:

    • Proteolysis-targeting chimeras (PROTACs) targeting RNF121

    • Molecular glues to promote RNF121 degradation

The M158R mutation in Helix 4 causes reduced RNF121 protein stability and absent Golgi localization, associated with loss of tumorigenicity. This suggests that targeting RNF121 stability or localization could be therapeutically beneficial in MYCN-driven cancers .

What crosstalk exists between RNF121 and other E3 ubiquitin ligases in protein quality control networks?

The integration of RNF121 within broader E3 ligase networks remains an emerging area of research:

Potential network interactions:

  • Complementary substrate targeting:

    • Other ER/Golgi-resident E3 ligases (e.g., HRD1, gp78) may have overlapping substrate specificity

    • Compensatory mechanisms may exist when one E3 ligase is dysfunctional

  • Hierarchical regulation:

    • Some E3 ligases may regulate the stability or activity of others

    • RNF121 itself could be regulated by other ubiquitin ligases

  • Co-factor sharing:

    • E3 ligases may compete for limiting E2 conjugating enzymes

    • Shared deubiquitinating enzymes may coordinate regulation

Experimental approaches to investigate crosstalk:

  • Combined knockout/knockdown of multiple E3 ligases

  • Proteome-wide ubiquitination profiling in single vs. double E3 ligase mutants

  • Interactome analysis to identify physical associations between E3 ligases

  • Epistasis analysis in model organisms to establish genetic relationships

Understanding this crosstalk would provide insights into redundancy and compensation in protein quality control systems, potentially explaining why some proteins are more sensitive to RNF121 loss than others .

Comparative Analysis of RNF121 Effects on Different Experimental Systems

Experimental SystemRNF121 Knockout/Mutation EffectRescue MethodKey Findings
AAV Transduction (Human cell lines)>99% reduction in transduction efficiencyRNF121 overexpression (partial rescue)Transcriptional arrest of AAV genomes; VCP/p97 inhibition restores transduction
Voltage-gated Sodium Channels (HEK293T cells)Reduced membrane localizationNavβ1 co-expressionRNF121 facilitates both degradation and membrane transport of Nav channels
Zebrafish Touch ResponseUnresponsiveness to tactile stimuliPartial rescue with Navβ1 overexpressionDose-dependent relationship between RNF121 levels and touch responsiveness
TH-MYCN Neuroblastoma (Mouse model)Heritable loss of tumorigenicity (M158R mutation)N/ARNF121 directly binds and stabilizes MYCN protein

This comparative analysis demonstrates that RNF121 has consistent yet context-specific functions across diverse biological systems, with its role in protein quality control and trafficking being a common mechanistic theme .

Essential Methods for RNF121 Research: A Technical Comparison

TechniqueApplicationAdvantagesLimitationsKey Controls
CRISPR-Cas9 RNF121 KnockoutFunctional studiesComplete protein elimination; stablePotential compensatory mechanisms; off-target effectsNon-targeting sgRNA; multiple independent clones
RNF121 OverexpressionRescue experiments; structure-functionCan test multiple mutants; controlled expressionPotential artifacts from non-physiological levelsEmpty vector; inactive mutants
Co-immunoprecipitationProtein-protein interactionsDetects native complexesMay miss transient interactions; buffer-dependentIgG controls; substrate-free conditions
Ubiquitination AssaysE3 ligase activityDirect measure of enzyme functionComplex setup; in vitro vs. in vivo differencesCatalytically inactive RNF121; E2 enzyme controls
Quantitative RT-PCRmRNA expression analysisSensitive; quantitativeDoesn't reflect protein levelsMultiple reference genes; no-RT controls

This table provides researchers with guidance on selecting and implementing appropriate methodologies for RNF121 studies, highlighting the technical considerations for each approach .

RNF121 Expression and Prognostic Significance Across Cancer Types

Cancer TypeRNF121 Expression PatternClinical CorrelationProposed MechanismReference
NeuroblastomaIncreased in MYCN-amplified tumorsHigh expression correlates with poor prognosisDirect binding and stabilization of MYCN
Laryngeal CancerFrequently upregulatedAssociated with poor outcomesMYC-driven pathway involvement
Other MYC-driven malignanciesVariable upregulationUnder investigationPotential conservation of MYCN stabilization mechanism

The prognostic significance of RNF121 expression appears particularly strong in cancers with MYC family oncogene dysregulation, suggesting a conserved oncogenic mechanism that could be exploited therapeutically .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.