Recombinant Roseiflexus castenholzii Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
rny; Rcas_0856; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Target Names
rny
Target Protein Sequence
MFEPVATARQRAVACCTFTTEQEDVVQWLVWALPALVIGLAIGAGIGILIYKNSVQSQIR QIEAEARLQLEATRSEQKDLILRATDEALRLRTEAEAQIREARAALAKQEERLQRKEENL DRKIEGLERRERQLQQRERQMEQLHQEAEHLRQQQRAELERISALSQEEARAIILKRVED ETRDEAARRIREIEKTMHEEADKLARKVISMAIQRCASDYVAEVTVSTVALPSEELKGRI IGREGRNIRAFEQLTGVDIIVDDTPEAVTLSCHDPVRREVARLALIKLLKDGRIHPTRIE EVVHKTQQEVDQVMREEGERVAYEANVQGLHPDLIKLLGRLKYRTSYGQNVLQHSLECAL LAAHIAAEIGANINVAKTAALLHDIGKAVDHEVQGPHALIGAEIARRLGKSPAIVHAIAA HHNDEEPQTVEAWLVQAVDAISGGRPGARRETLDLYIKRLEALETVATSFSGVQRAFAVQ AGREVRVMVQPDAIDDLGSIHLARDVAKKIEESLQYPGQIKVTVIRETRAVDYAR
Uniprot No.

Target Background

Function

Endoribonuclease initiating mRNA decay.

Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Roseiflexus castenholzii Ribonuclease Y and what is its function?

Ribonuclease Y (RNase Y) from Roseiflexus castenholzii is an endoribonuclease that initiates mRNA decay in bacterial cells . As a member of the RNase Y family, it plays a crucial role in RNA metabolism, similar to its homologs in other bacterial species. Based on studies of RNase Y in model organisms like Bacillus subtilis, this enzyme is involved in the regulation of RNA turnover, which is essential for proper cellular function and adaptation to changing environmental conditions . The enzyme typically acts as an endonuclease, making internal cuts in RNA molecules to initiate their degradation, thus contributing to RNA homeostasis in the cell.

What expression systems are optimal for producing recombinant R. castenholzii RNase Y?

Expression System Recommendations:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, well-established protocolsPotential inclusion body formation due to membrane protein nature
E. coli C41/C43(DE3)Specialized for membrane proteinsMay provide better soluble yields than standard BL21
Cell-free expressionAvoids toxicity issues, suitable for membrane proteinsHigher cost, potentially lower yields

Given the membrane-associated nature of RNase Y, as evident from its B. subtilis homolog and sequence features , expression strategies should accommodate this characteristic. Using a milder induction protocol (lower IPTG concentration, lower temperature) may help improve soluble protein yield. Adding a solubility-enhancing tag (such as MBP or SUMO) might also facilitate proper folding and solubility.

What are the recommended purification protocols for R. castenholzii RNase Y?

Purification of recombinant R. castenholzii RNase Y requires careful consideration of its membrane-associated nature. A suggested purification workflow is:

  • Cell Lysis: Use detergent-containing buffers (e.g., 1% Triton X-100 or n-dodecyl β-D-maltoside) to solubilize the membrane-associated protein.

  • Initial Purification: Affinity chromatography using an appropriate tag (His-tag, FLAG-tag, etc.) to capture the recombinant protein.

  • Secondary Purification: Size exclusion chromatography to separate the target protein from aggregates and other contaminants.

  • Quality Control: SDS-PAGE and Western blotting to confirm protein purity and identity.

Buffer Recommendations:

Purification StageBuffer CompositionPurpose
Cell Lysis50 mM Tris-HCl pH 7.5, 300 mM NaCl, 1% Triton X-100, 10% glycerol, protease inhibitorsSolubilization of membrane proteins
Affinity Purification50 mM Tris-HCl pH 7.5, 300 mM NaCl, 0.1% Triton X-100, 10% glycerolMaintain protein solubility while reducing detergent concentration
Size Exclusion25 mM HEPES pH 7.5, 150 mM NaCl, 0.05% Triton X-100, 5% glycerolFurther purification with physiological buffer conditions

How can I verify the activity of purified recombinant R. castenholzii RNase Y?

To verify the enzymatic activity of purified recombinant R. castenholzii RNase Y, an RNA degradation assay should be performed. RNase Y functions as an endoribonuclease that initiates mRNA decay , so its activity can be assessed by monitoring the degradation of a model RNA substrate.

Recommended Activity Assay Protocol:

  • Substrate Preparation: Synthesize or purchase a fluorescently labeled RNA substrate. A 5′-FAM or 3′-TAMRA labeled RNA oligonucleotide (25-30 nucleotides) can serve as a suitable substrate.

  • Reaction Setup:

    • Reaction buffer: 25 mM Tris-HCl pH 7.5, 100 mM KCl, 5 mM MgCl₂, 1 mM DTT

    • Add purified recombinant RNase Y (typically 10-100 nM)

    • Add labeled RNA substrate (50-100 nM)

    • Incubate at 37°C for 15-60 minutes

  • Analysis Methods:

    • Denaturing PAGE to visualize RNA degradation products

    • Fluorescence-based real-time monitoring if using fluorescently labeled substrates

    • HPLC or capillary electrophoresis for quantitative analysis of degradation products

Controls to Include:

  • Negative control: Heat-inactivated RNase Y (95°C for 5 minutes)

  • Positive control: Commercial RNase A (though note the different cleavage specificities)

  • Substrate stability control: RNA substrate without any enzyme

How can R. castenholzii RNase Y be used in RNA degradation studies?

R. castenholzii RNase Y can serve as a valuable tool for studying RNA degradation mechanisms in several experimental contexts:

  • Comparative Studies: Investigating differences in substrate specificity and activity between RNase Y from R. castenholzii and other bacterial species can provide insights into the evolution of RNA degradation pathways.

  • RNA Turnover Analysis: Using the recombinant enzyme to study the degradation kinetics of different RNA substrates can help elucidate the principles governing RNA stability and turnover in bacteria.

  • Structure-Function Relationships: Creating site-directed mutants of R. castenholzii RNase Y to identify key residues involved in catalysis, substrate binding, or protein-protein interactions.

  • Reconstitution Experiments: Combining R. castenholzii RNase Y with other components of the RNA degradation machinery (e.g., RNase J1, polynucleotide phosphorylase) to reconstitute the degradosome complex in vitro .

Based on studies of RNase Y in B. subtilis, where it plays a crucial role in RNA metabolism and interacts with various other proteins involved in RNA degradation , R. castenholzii RNase Y likely participates in similar processes and could serve as a model for studying these interactions.

What controls should be included in experiments using recombinant R. castenholzii RNase Y?

When designing experiments with recombinant R. castenholzii RNase Y, including appropriate controls is critical for result interpretation:

Essential Controls for RNase Y Experiments:

Control TypeDescriptionPurpose
Catalytically Inactive MutantRNase Y with mutation in the catalytic siteDistinguishes between specific enzymatic activity and non-specific effects
Heat-Inactivated EnzymeRNase Y heated to 95°C for 5 minutesConfirms that observed effects are due to enzymatic activity
RNase Inhibitor ControlAddition of RNase inhibitors to reactionVerifies specificity of observed activity
Substrate SpecificityTesting multiple RNA substratesDetermines substrate preferences
Time CourseSampling at multiple time pointsEstablishes reaction kinetics
Buffer ControlsReactions with buffer components individually omittedIdentifies essential cofactors for activity

An inactive RNase Y mutant can be generated by identifying and mutating key catalytic residues based on structural similarities with other RNase Y family members, though specific catalytic residues in R. castenholzii RNase Y would need to be identified through sequence alignment with better-characterized orthologs.

How stable is recombinant R. castenholzii RNase Y under various experimental conditions?

Understanding the stability of recombinant R. castenholzii RNase Y is crucial for designing robust experiments. While specific stability data for this particular enzyme is not available in the search results, general considerations for ribonucleases and membrane-associated proteins apply:

Predicted Stability Under Various Conditions:

ConditionExpected StabilityRecommendations
TemperatureModerate stability at 4°C; limited stability at room temperatureStore at -80°C for long-term; use at 4-37°C for experiments
pHLikely optimal activity at pH 7.0-8.0Buffer at physiological pH; avoid extremes
Salt ConcentrationModerate to high salt may stabilizeInclude 100-300 mM NaCl or KCl in storage buffers
Freeze-Thaw CyclesLimited tolerance to multiple cyclesAliquot and avoid repeated freezing and thawing
DetergentsRequires detergents for solubilityInclude mild detergents (0.05-0.1% Triton X-100)
Reducing AgentsMay contain sensitive cysteine residuesInclude 1-5 mM DTT or 2-10 mM β-mercaptoethanol

For optimal stability during storage, a recommended buffer would be 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% Triton X-100, 10% glycerol, 1 mM DTT. Store the protein in small aliquots at -80°C to minimize freeze-thaw cycles.

How does R. castenholzii RNase Y interact with other components of the RNA degradation machinery?

Based on studies of RNase Y in B. subtilis, we can infer potential interactions for the R. castenholzii ortholog. In B. subtilis, RNase Y interacts with several proteins involved in RNA degradation, including the 5′-to-3′ exoribonuclease RNase J1, polynucleotide phosphorylase, the RNA helicase CshA, glycolytic proteins (enolase and phosphofructokinase), and a protein complex composed of YaaT, YlbF, and YmcA .

To investigate potential protein-protein interactions of R. castenholzii RNase Y, several approaches could be employed:

  • Co-immunoprecipitation: Using tagged recombinant RNase Y to pull down interacting partners from R. castenholzii lysates.

  • Bacterial Two-Hybrid Assays: Testing specific predicted interactions based on known partners of RNase Y in other bacterial species.

  • Proximity Labeling: Using techniques like BioID or APEX to identify proteins in close proximity to RNase Y in vivo.

  • In vitro Reconstitution: Combining purified recombinant RNase Y with potential partners to observe effects on enzymatic activity.

These interactions are likely crucial for coordinating RNA metabolism, as suggested by studies in B. subtilis where RNase Y forms part of a degradosome-like complex that regulates RNA turnover .

What are the known substrate specificities of R. castenholzii RNase Y?

RNase Y typically shows preference for single-stranded regions of RNA and may have sequence specificity. In B. subtilis, RNase Y plays a key role in initiating mRNA decay , suggesting a similar function in R. castenholzii.

Proposed Experiment to Determine Substrate Specificity:

  • Library-Based Approach: Create a pool of diverse RNA sequences and identify cleaved products by high-throughput sequencing.

  • Systematic Substrate Variation: Test a series of RNA substrates with systematic variations in sequence and structure to identify preferred features.

  • Transcriptome-Wide Analysis: Perform RNA-seq on R. castenholzii with and without RNase Y to identify transcripts affected by the enzyme in vivo.

The tight cooperation observed between RNase Y and RNA polymerase in B. subtilis suggests that substrate specificity may be linked to transcriptional processes, possibly involving recognition of specific RNA structural elements or sequence motifs associated with newly transcribed RNAs.

How can I design experiments to investigate the regulatory mechanisms affecting RNase Y activity?

To investigate regulatory mechanisms affecting R. castenholzii RNase Y activity, consider the following experimental approaches:

  • Transcriptional Regulation:

    • qRT-PCR analysis of rny gene expression under different growth conditions

    • Promoter analysis to identify potential regulatory elements

    • ChIP-seq to identify transcription factors binding to the rny promoter

  • Post-translational Modifications:

    • Mass spectrometry analysis of purified RNase Y to identify potential phosphorylation, acetylation, or other modifications

    • Site-directed mutagenesis of predicted modification sites to assess functional impact

    • In vitro modification assays using relevant kinases or other modifying enzymes

  • Protein-Protein Interactions:

    • Identify interaction partners that may regulate RNase Y activity

    • Assess how these interactions change under different cellular conditions

    • Test the effect of interacting proteins on RNase Y activity in vitro

  • RNA Polymerase Connection:
    Based on findings in B. subtilis where suppressor mutations affecting RNA polymerase subunits were found to compensate for RNase Y deletion , investigate the relationship between RNase Y and RNA polymerase:

    • Test how alterations in RNA polymerase activity affect RNase Y function

    • Investigate whether RNase Y directly interacts with RNA polymerase components

    • Examine if transcription rate influences RNase Y substrate selection

This approach is supported by research showing that in B. subtilis, the absence of RNase Y leads to suppressor mutations in RNA polymerase genes, suggesting a functional link between transcription and RNA degradation .

Why might recombinant R. castenholzii RNase Y show low or no enzymatic activity?

Several factors could contribute to low or absent enzymatic activity in recombinant R. castenholzii RNase Y preparations:

Common Causes of Low Enzymatic Activity:

IssuePossible CausesSolutions
Improper FoldingRapid expression, inclusion body formationLower induction temperature, use solubility tags, optimize codon usage
Missing CofactorsAbsence of necessary metal ions or other cofactorsTest activity with different divalent cations (Mg²⁺, Mn²⁺, Ca²⁺)
Detergent EffectsInappropriate detergent type or concentration affecting structureScreen different detergents at varying concentrations
Inhibitory ContaminantsCo-purified nucleic acids or proteinsInclude additional purification steps, add nuclease treatment during purification
Post-translational ModificationsMissing essential modifications present in native proteinExpress in eukaryotic systems if modifications are suspected to be critical
Buffer IncompatibilitySuboptimal pH, salt concentration, or reducing conditionsSystematically test buffer components to optimize conditions

Given that RNase Y is a membrane-associated protein in B. subtilis , proper solubilization and maintenance of the structural integrity of the R. castenholzii ortholog could be particularly challenging. Ensuring appropriate detergent conditions throughout purification and storage is critical.

How can I resolve solubility issues with recombinant R. castenholzii RNase Y?

Solubility issues are common when working with membrane-associated proteins like RNase Y . Several strategies can be employed to improve solubility:

  • Expression Optimization:

    • Lower the induction temperature (16-20°C)

    • Reduce inducer concentration

    • Use slower expression strains (e.g., Arctic Express)

    • Consider cell-free expression systems

  • Fusion Tags:

    • MBP (Maltose Binding Protein) – highly effective for enhancing solubility

    • SUMO – aids in proper folding and can be precisely removed

    • Thioredoxin – stabilizes disulfide bonds

    • GST – provides solubility benefits though can form dimers

  • Detergent Screening:
    Systematically test different detergents for their ability to solubilize RNase Y while maintaining activity:

    Detergent ClassExamplesConcentration Range
    Non-ionicTriton X-100, DDM, n-Octyl-β-D-glucoside0.05-1%
    ZwitterionicCHAPS, LDAO0.1-1%
    Mild IonicSodium cholate0.1-0.5%
    Polymer-basedAmphipol A8-35, SMAAs recommended by manufacturer
  • Buffer Optimization:

    • Test different pH ranges (typically pH 6.5-8.5)

    • Vary salt concentration (100-500 mM NaCl)

    • Include stabilizing additives (5-10% glycerol, 100-200 mM sucrose)

    • Add reducing agents (1-5 mM DTT)

The membrane-associated nature of RNase Y, as evidenced by its B. subtilis homolog , suggests that proper solubilization conditions are critical for maintaining both solubility and activity.

What approaches can help overcome problems with protein stability during storage?

Maintaining the stability of recombinant R. castenholzii RNase Y during storage is crucial for consistent experimental results. Several approaches can enhance storage stability:

Strategies to Improve Storage Stability:

  • Optimize Storage Buffer:

    • Buffer: 25-50 mM Tris-HCl or HEPES pH 7.5

    • Salt: 150-300 mM NaCl to prevent aggregation

    • Stabilizers: 10-20% glycerol or 5-10% sucrose

    • Reducing agent: 1-5 mM DTT or 2-10 mM β-mercaptoethanol

    • Detergent: 0.05-0.1% Triton X-100 or other suitable detergent

  • Storage Conditions:

    • Store as concentrated as possible (ideally >1 mg/ml)

    • Divide into small aliquots (20-50 μl) to minimize freeze-thaw cycles

    • Flash-freeze in liquid nitrogen before storing at -80°C

    • For working stocks, store at -20°C for up to 1 week

  • Stabilizing Additives:

    • Protease inhibitors (PMSF, EDTA, or commercial cocktails)

    • RNase inhibitors (to prevent contaminating RNases from degrading substrates)

    • Carrier proteins (0.1% BSA for dilute solutions)

  • Lyophilization:

    • Consider lyophilization for long-term storage if the protein tolerates the process

    • Include lyoprotectants like trehalose or sucrose

    • Test activity recovery after reconstitution

  • Stability Testing Protocol:

    • Test the activity of stored protein at regular intervals (0, 1, 2, 4, 8 weeks)

    • Compare different storage conditions to identify optimal approach

    • Document stability trends to predict useful storage duration

For membrane proteins like RNase Y , maintaining the integrity of the detergent micelle during storage is particularly important, as detergent precipitation can lead to protein aggregation and loss of activity.

How can R. castenholzii RNase Y be used to study RNA metabolism in thermophilic bacteria?

R. castenholzii is a thermophilic filamentous anoxygenic phototrophic bacterium, and its RNase Y likely plays a crucial role in RNA metabolism adapted to higher temperatures. This presents unique research opportunities:

  • Thermostability Studies:

    • Compare the thermal stability of R. castenholzii RNase Y with mesophilic homologs

    • Identify structural features contributing to thermostability

    • Investigate how RNA degradation mechanisms adapt to higher temperatures

  • Evolution of RNA Processing:

    • Use comparative analysis between thermophilic and mesophilic RNase Y to understand evolutionary adaptations

    • Identify conserved versus divergent features across bacterial phyla

    • Map the evolution of RNA degradation mechanisms across diverse ecological niches

  • Biotechnological Applications:

    • Exploit potential thermostability for developing heat-resistant RNA processing tools

    • Investigate applications in molecular biology techniques requiring ribonuclease activity at elevated temperatures

    • Engineer chimeric enzymes combining desirable features from different RNase Y homologs

The unique properties of enzymes from thermophilic organisms often make them valuable tools for biotechnology applications and model systems for understanding protein adaptation to extreme environments.

What insights can be gained from studying the relationship between RNase Y and RNA polymerase?

The relationship between RNase Y and RNA polymerase appears to be functionally significant, as evidenced by studies in B. subtilis where suppressor mutations affecting RNA polymerase subunits compensated for RNase Y deletion . This connection offers several research directions:

  • Transcription-Degradation Coupling:

    • Investigate if R. castenholzii RNase Y physically associates with RNA polymerase

    • Study how transcription rate affects RNA degradation efficiency

    • Examine if newly synthesized transcripts are preferentially targeted by RNase Y

  • Experimental Approaches:

    • Co-immunoprecipitation to detect physical interactions between RNase Y and RNA polymerase

    • In vitro transcription-coupled RNA degradation assays

    • Single-molecule studies to visualize potential co-localization

  • RNA Homeostasis Model:

    • Develop mathematical models describing the balance between RNA synthesis and degradation

    • Test predictions of these models experimentally

    • Investigate how perturbations in either system affect global RNA levels

Research in B. subtilis has shown that RNA polymerase mutations that reduce transcription efficiency can compensate for the absence of RNase Y , suggesting that balancing RNA synthesis and degradation is critical for bacterial viability. Similar mechanisms might operate in R. castenholzii, making it an interesting model for studying this fundamental aspect of RNA metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.