Recombinant Roseiflexus sp. ATP synthase subunit b (atpF)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please contact us in advance as additional fees may apply.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
atpF; RoseRS_0516; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Roseiflexus sp. (strain RS-1)
Target Names
atpF
Target Protein Sequence
MEKLGINWGLLIAQLINVIFVVWLLTTFLYRPILNMLNQRTSRIQEGLQDAEKVKEQLANAKRDYDAELAKARQEAAAILAQAQERARAQAAEIIAQAHRDAEKIKSDALAQAEQERLRMLGELKDRMAELVVLTAERVLGEELKTNHDRLIEESLAELGKYN
Uniprot No.
Target Background
Function
F(1)F(0) ATP synthase catalyzes the synthesis of ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1), which houses the extramembraneous catalytic core, and F(0), which contains the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit forms part of the peripheral stalk, connecting F(1) to F(0).
Database Links
KEGG: rrs:RoseRS_0516
STRING: 357808.RoseRS_0516
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
