Recombinant Roseiflexus sp. Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function in Cobalamin Biosynthesis

cobS catalyzes the condensation of AdoCbi-GDP and α-RP to form adenosylcobalamin-5′-phosphate (AdoCbl-P), the penultimate step in coenzyme B12 production . Key mechanistic insights include:

  • Substrate specificity: Requires Mg²⁺ as a cofactor for phosphoribosyl transfer .

  • Membrane interaction: Overexpression in E. coli disrupts membrane potential, necessitating coexpression with CobC phosphatase or phage shock protein A (PspA) to maintain viability .

Production and Purification

  • Expressed in E. coli with high solubility, enabling large-scale purification via nickel-affinity chromatography .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

Biotechnological Relevance

  • Vitamin B12 biosynthesis: Critical for industrial production of cobalamin derivatives .

  • Metabolic engineering: Used to study CO2 fixation pathways in Roseiflexus spp., which employ the 3-hydroxypropionate cycle .

Research Findings and Challenges

  • Structural dynamics: While high-resolution structures of cobS remain unresolved, homologs in Roseiflexus castenholzii (e.g., malonyl-CoA reductase) have been analyzed at 2.0–3.35 Å, providing indirect insights into catalytic mechanisms .

  • Functional redundancy: Genomic clusters in Chloroflexi (e.g., cobS with cobC) suggest coordinated regulation of B12 synthesis .

  • Expression toxicity: Unregulated cobS activity in E. coli dissipates proton motive force, highlighting the need for balanced cofactor systems .

Future Directions

  • Structural studies: Cryo-EM or crystallography to resolve active-site architecture.

  • Pathway optimization: Engineering cobS with CobC or PspA to enhance industrial yield .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is preferred, please communicate with us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; RoseRS_4584; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Roseiflexus sp. (strain RS-1)
Target Names
cobS
Target Protein Sequence
MSSEDTTSQRAPRNWWGPFAPIGEALRFLTILPVPGLPPMSEEAIPQSIRYFPIAGLVIG GILAAVGWGAGVLWNETVRAVVLVVAWGVLTAGMHLDGLSDTFDGVMSWRSRERKLEIMR DSRIGVMGALALAAVLGLKAAFLAGAGDAWLTAVVLAPVLGRWADVYGIVRFPPAREGGL GRTFQSYLRPGDFAGASVATLALALIVGGVGGLIALALVWMVTHLLGRWWTRDLGGLTGD TYGALCEIAEVVALATLTLSAPMRLLAT
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and alpha-ribazole. Additionally, it facilitates the production of adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (CobS) and what biochemical reaction does it catalyze?

Cobalamin synthase (CobS) is an integral membrane protein that catalyzes the penultimate step in cobalamin (vitamin B12) biosynthesis. Specifically, CobS condenses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole phosphate (α-RP) to yield adenosylcobalamin phosphate (AdoCbl-P) . This represents a critical convergence point where the activated corrin ring and lower ligand base are joined together in the nucleotide loop assembly process . In the subsequent and final step of the pathway, AdoCbl-P is dephosphorylated by the CobC enzyme (EC 3.1.3.73) to yield adenosylcobalamin (AdoCbl) .

The biochemical significance of CobS lies in its pivotal role linking two separate metabolic pathways into the unified production of vitamin B12, making it an essential enzyme for organisms capable of de novo B12 synthesis.

How does the membrane localization of CobS relate to its function?

The membrane association of CobS appears to be evolutionarily conserved among all cobamide producers, although the physiological relevance of this association remains incompletely understood . Research suggests that membrane localization may serve several purposes:

  • Creation of a localized environment for efficient substrate channeling between multiple enzymes in the cobalamin biosynthetic pathway

  • Facilitation of interactions with other membrane-associated enzymes involved in the pathway

  • Protection of reactive intermediates from the cytoplasmic environment

Researchers have hypothesized that the late steps of cobamide biosynthesis (nucleotide loop assembly) are catalyzed by a multienzyme complex associated with the cell membrane, including enzymes such as CbiB, CobU, CobT, CobC, and CobS . This membrane association might be particularly important for handling the hydrophobic corrin ring structure and facilitating precise orientation of substrates during catalysis.

What expression systems are optimal for producing functional recombinant Roseiflexus sp. CobS?

Escherichia coli represents the primary expression system for recombinant Roseiflexus sp. CobS production, as evidenced by commercial preparations . Key methodological considerations include:

  • Vector selection: Vectors containing strong inducible promoters (T7, tac) with appropriate fusion tags (His-tag) facilitate expression and purification.

  • E. coli strain optimization: BL21(DE3) derivatives lacking proteases are typically preferred for membrane protein expression.

  • Induction conditions: Lower temperatures (16-25°C) after induction may improve proper folding of membrane proteins.

  • Membrane fraction isolation: Careful isolation of membrane fractions through differential centrifugation following cell lysis is critical.

The purification protocol described for Salmonella Typhimurium CobS provides a useful methodological framework, yielding approximately 96% homogenous protein after optimization . This approach could be adapted for Roseiflexus sp. CobS with appropriate modifications to account for species-specific differences.

What reconstitution methods enable functional studies of purified CobS?

Reconstitution of purified CobS into liposomes represents a powerful approach for studying its function in a membrane environment . A methodological approach includes:

  • Liposome preparation: Synthetic phospholipids (typically a mixture of phosphatidylcholine, phosphatidylethanolamine, and phosphatidylglycerol) are dissolved in organic solvent, dried, and resuspended in buffer.

  • Protein incorporation: Detergent-solubilized CobS is mixed with preformed liposomes, followed by detergent removal through dialysis or adsorption to Bio-Beads.

  • Verification of incorporation: Sucrose gradient centrifugation and freeze-fracture electron microscopy can confirm protein incorporation.

  • Activity assessment: Enzymatic activity of reconstituted CobS can be measured by monitoring the conversion of AdoCbi-GDP and α-RP to AdoCbl-P.

This methodology enables researchers to investigate how the lipid bilayer environment affects CobS function, substrate binding, and catalytic efficiency .

What analytical techniques are suitable for studying substrate binding and enzyme kinetics of CobS?

Several complementary techniques can be employed to study substrate binding and kinetics:

  • Isothermal titration calorimetry (ITC): Measures thermodynamic parameters of substrate binding.

  • Surface plasmon resonance (SPR): Determines binding kinetics in real-time.

  • Fluorescence spectroscopy: Uses intrinsic tryptophan fluorescence or labeled substrates to monitor binding events.

  • Radioactive substrate assays: Tracks conversion of radiolabeled substrates to products.

For in vitro substrate binding analysis, researchers have successfully employed techniques to identify residues and motifs essential for CobS function . When designing such experiments, it's important to consider:

  • Detergent effects on enzyme activity and substrate accessibility

  • The potential requirement for specific lipids to maintain proper protein conformation

  • The need for coupled enzyme assays when direct product detection is challenging

How do mutations in conserved residues affect CobS catalytic activity?

In vivo CobS variant analyses have identified several residues and motifs critical for cobamide synthase function . A systematic approach to studying structure-function relationships includes:

  • Sequence alignment: Multiple sequence alignment of CobS homologs identifies conserved residues across species.

  • Site-directed mutagenesis: Targeted mutation of conserved residues (to alanine or functionally similar amino acids).

  • Complementation assays: Testing mutant variants for ability to restore cobalamin synthesis in CobS-deficient strains.

  • Biochemical characterization: Comparing substrate binding and catalytic parameters of purified mutant enzymes.

Key residues likely include those involved in substrate binding (particularly those interacting with the corrin ring and the α-ribazole phosphate), coordination of metal cofactors, and catalytic activity. Mutation studies also reveal which structural elements are essential for proper membrane integration versus catalytic function.

What is the relationship between CobS and other enzymes in the cobalamin biosynthetic pathway?

CobS functions as part of a complex network of enzymes involved in cobalamin biosynthesis. Key interactions include:

  • Functional cooperation with CobC: CobS produces AdoCbl-P, which is subsequently dephosphorylated by CobC to yield the final AdoCbl product .

  • Potential interactions with upstream enzymes: CobS may interact with enzymes involved in corrin ring synthesis and activation.

  • Coordination with DMB synthesis pathway: The synthesis of the lower ligand (typically 5,6-dimethylbenzimidazole, DMB) must be coordinated with CobS activity .

Research suggests that the late steps of cobamide biosynthesis may involve a multienzyme complex associated with the cell membrane, including CbiB, CobU, CobT, CobC, and CobS . Understanding these interactions requires techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or in situ crosslinking followed by mass spectrometry.

How does CobS from Roseiflexus sp. differ from CobS in other prokaryotes?

Comparative analysis of CobS across species reveals important evolutionary and functional insights:

OrganismPathway TypeCobS Size (aa)Key Structural FeaturesHabitat
Roseiflexus sp.Aerobic268Multiple transmembrane domainsThermal springs
Pseudomonas denitrificansAerobic~300Similar membrane topologySoil
Salmonella TyphimuriumAnaerobic~270Different membrane integrationEnteric

Different organisms may utilize either the aerobic or anaerobic pathway for cobalamin biosynthesis, with significant variations in early steps but convergence at the late stages involving CobS . The aerobic pathway requires molecular oxygen for ring contraction and cobalt insertion, while the anaerobic pathway inserts cobalt at an earlier stage .

The differences in CobS between these pathways may reflect adaptations to specific ecological niches and metabolic constraints. Roseiflexus sp., being a thermophilic bacterium, likely has adaptations for protein stability at elevated temperatures.

How might understanding CobS function contribute to biotechnological applications?

Research on CobS has several potential biotechnological applications:

  • Enhanced vitamin B12 production: Understanding rate-limiting steps and regulatory mechanisms could lead to improved industrial strains for vitamin B12 production beyond current capabilities of Propionibacterium shermanii and Pseudomonas denitrificans (which produce up to 300 mg/L) .

  • Engineered pathways: Synthetic biology approaches could introduce optimized cobalamin biosynthesis pathways into industrially relevant organisms.

  • Antimicrobial development: As cobalamin biosynthesis is essential for many pathogenic bacteria but absent in humans, inhibitors of CobS could represent novel antimicrobial targets.

Addressing these applications requires combining structural studies, catalytic mechanism elucidation, and metabolic engineering approaches.

What challenges remain in understanding CobS structure and mechanism?

Despite progress in CobS research, several significant challenges remain:

  • Structural characterization: As an integral membrane protein, obtaining high-resolution structural data (via X-ray crystallography or cryo-EM) remains difficult.

  • Reaction intermediates: Capturing transient intermediates in the condensation reaction poses technical challenges.

  • Membrane requirements: Understanding the specific lipid requirements for optimal CobS function requires systematic analysis.

  • Regulatory mechanisms: The regulation of CobS expression and activity in response to environmental conditions is poorly understood.

Addressing these challenges will require interdisciplinary approaches combining advanced structural biology techniques, biophysical methods for studying membrane proteins, and systems biology perspectives on metabolic regulation.

How does thermostability affect the function of Roseiflexus sp. CobS?

Roseiflexus sp. is a thermophilic bacterium, suggesting its CobS enzyme possesses adaptations for function at elevated temperatures. Research considerations include:

  • Thermostability determinants: Identifying structural features that contribute to thermal stability (e.g., increased hydrophobic interactions, additional salt bridges, compact packing).

  • Activity-stability relationship: Investigating how thermostability affects catalytic efficiency across temperature ranges.

  • Membrane composition effects: Examining how different lipid compositions affect enzyme stability and activity at various temperatures.

Understanding these thermal adaptations could inform protein engineering efforts to enhance stability of enzymes for biotechnological applications.

What are the optimal storage and handling conditions for recombinant Roseiflexus sp. CobS?

Based on commercial product information, researchers should consider the following storage and handling guidelines:

  • Storage temperature: Store at -20°C/-80°C upon receipt, with working aliquots kept at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided to maintain enzyme activity .

  • Storage buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0 is recommended for storage .

  • Glycerol addition: Addition of 5-50% glycerol (final concentration) is recommended for long-term storage .

  • Reconstitution: Protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Following these guidelines helps maintain protein integrity and enzymatic activity for experimental use.

What controls should be included in functional assays of recombinant CobS?

When designing functional assays for CobS, researchers should include several controls:

  • Negative controls:

    • Heat-inactivated enzyme to confirm that observed activity is enzyme-dependent

    • Reactions lacking individual substrates to verify substrate specificity

    • Detergent-only controls when using detergent-solubilized enzyme

  • Positive controls:

    • Well-characterized CobS from model organisms (e.g., Salmonella) when available

    • Coupled enzyme systems with known activity rates

  • Specificity controls:

    • Testing related but non-substrate compounds to confirm specificity

    • Inhibitor studies to verify catalytic mechanism

These controls help distinguish genuine enzymatic activity from artifacts and provide benchmarks for comparing experimental results across different conditions or enzyme variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.