Recombinant Roseiflexus sp. Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Roseiflexus sp. Cobalt Transport Protein CbiM (cbiM)

Recombinant Roseiflexus sp. cobalt transport protein CbiM (cbiM) is a genetically engineered protein involved in cobalt uptake and homeostasis in bacteria. It belongs to the energy-coupling factor (ECF) transporter family, functioning as the substrate-capture component responsible for binding and delivering cobalt ions to the transmembrane channel . This protein is critical for microbial survival under cobalt-limited conditions and has been studied for its structural and functional roles in metal ion transport .

Protein Architecture

CbiM is a transmembrane protein with the following features:

  • Gene locus: cbiM (e.g., RoseRS_0560 in Roseiflexus sp. strain RS-1) .

  • Amino acid sequence: Comprises 222 residues (positions 28–249 in the full-length precursor) .

  • Domains: Contains a conserved N-terminal His tag for purification, followed by hydrophobic regions critical for cobalt binding and membrane insertion .

Functional Role

CbiM operates as part of an ECF transporter complex, which includes:

  • CbiN: A transmembrane protein that interacts dynamically with CbiM to activate cobalt transport .

  • ATP-binding proteins: Provide energy for cobalt translocation .
    CbiM specifically captures cobalt ions, enabling their import into the cell. This system is essential for biosynthesis of cobalamin (vitamin B₁₂) and other cobalt-dependent enzymes .

Expression and Purification

Recombinant CbiM is produced in E. coli with the following protocols:

  1. Cloning: The cbiM gene is codon-optimized and inserted into a plasmid under a strong bacterial promoter .

  2. Induction: Expression is induced using IPTG, followed by purification via immobilized metal affinity chromatography (IMAC) leveraging the His tag .

  3. Quality control: Validated by SDS-PAGE, mass spectrometry, and functional assays for cobalt binding .

Research Applications

  • Mechanistic studies: Used to elucidate cobalt transport dynamics in ECF systems .

  • Biotechnological engineering: Explored for biofortification or bioremediation of cobalt .

  • Structural biology: High-resolution cryo-EM and X-ray crystallography studies to map cobalt-binding sites .

Cobalt Binding and Transport

  • CbiM binds cobalt with high specificity, facilitated by conserved residues (e.g., Met11, Ser35, Trp40) that coordinate the metal ion .

  • Mutations in cbiM disrupt cobalt uptake, impairing bacterial growth in cobalt-deficient environments .

Interaction with ECF Transporter Components

  • CbiM forms a heterodimer with CbiN, creating a channel for cobalt translocation .

  • ATP hydrolysis by the ECF complex drives conformational changes in CbiM, enabling ion release into the cytoplasm .

Table 2: Comparative Analysis of CbiM Homologs

OrganismProtein IDKey FeaturesReference
Roseiflexus sp.A5UQS9222 residues, ECF substrate-capture protein
Halobacterium salinarumB0R611220 residues, similar cobalt-binding motifs
Sinorhizobium meliloti-Regulated by B₁₂ riboswitch

Challenges and Future Directions

  • Structural dynamics: The mechanism of cobalt release from CbiM remains poorly understood .

  • Engineering applications: Optimizing CbiM for industrial cobalt recovery or biosensing requires further mutational analysis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cbiM; RoseRS_0560; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-249
Protein Length
Full Length of Mature Protein
Species
Roseiflexus sp. (strain RS-1)
Target Names
cbiM
Target Protein Sequence
MHIMEGFLPPVWAGFWFIVVLPFWVLGLRRINRLIAGKPETRLLLGFAAAFAFVLSALKI PSVTGSSSHPTGTGLGTILFGPLVMSVLGSIVLLFQALLIAHGGLTTLGANAFSMAVVGP FVAWLIWKGLKDRAPIWLTVFLAAALADLFTYVVTSAQLALAYPDAVGGFAASFARFGAI FAVTQIPLAISEGILTVLIFNALQANAQTELQSLGVLKGAQA
Uniprot No.

Target Background

Function
CbiM is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Roseiflexus sp. Cobalt transport protein CbiM and what is its role in bacterial metabolism?

CbiM is a transmembrane protein that functions as the substrate-capture component of an Energy-coupling factor (ECF) transport system in Roseiflexus sp. (strain RS-1). It specifically facilitates the uptake of cobalt ions, which are essential cofactors for various metabolic processes, particularly cobalamin (vitamin B12) biosynthesis. The protein is officially designated as "Cobalt transport protein CbiM" with the alternative name "Energy-coupling factor transporter probable substrate-capture protein CbiM" (ECF transporter S component CbiM) . CbiM represents a critical component in the prokaryotic metal ion homeostasis system, with the gene being identified in the Roseiflexus sp. genome as RoseRS_0560 . This protein belongs to a larger family of ECF transporters that couple substrate translocation with ATP hydrolysis, making it essential for bacterial survival in environments where cobalt availability may be limited.

How does CbiM interact with other components of the cobalt transport system?

CbiM functions as part of a multicomponent ECF transporter system where it interacts with several other proteins to facilitate cobalt uptake. The complete functional unit typically includes:

  • CbiM (S component) - Substrate-binding component that provides specificity for cobalt ions

  • CbiQ (T component) - Transmembrane component that forms the translocation pathway

  • CbiO (A component) - ATP-binding cassette protein that provides energy through ATP hydrolysis

  • CbiN - Additional membrane protein specific to cobalt transport systems

Sequence comparison studies have demonstrated significant homology between the S (CbiM) and T (CbiQ) subunits with comparison scores of 11.9 standard deviations, sufficient to establish homology . The interaction between these components is dynamic, with recent research indicating that "dynamic interactions of CbiN and CbiM trigger activity of a cobalt energy-coupling-factor transporter" . The EAA motif, which is involved in ATPase binding in many ABC transporters, is present in the last halves of the T subunits (CbiQ) but not in the S subunits (CbiM) . This structural arrangement suggests a specific mechanism of energy coupling between the components of the transport system.

What methodologies are most effective for expressing and purifying recombinant Roseiflexus sp. CbiM?

Recombinant expression of CbiM presents significant challenges due to its multiple transmembrane domains. The following methodological approach has proven effective:

Expression System Selection:

  • E. coli BL21(DE3) strain with pET-based vectors incorporating a C-terminal His-tag is recommended for initial expression attempts

  • Alternative hosts such as C43(DE3) may be more suitable for membrane proteins if toxicity is observed

Expression Conditions:

ParameterOptimized ConditionRationale
Temperature18-20°CReduces inclusion body formation
Induction0.1-0.5 mM IPTGLower concentrations favor proper folding
MediaTB or 2YT with supplementsHigher cell density and protein yield
Growth phaseMid-log phase (OD600 0.6-0.8)Optimal cellular resources for expression
Duration16-20 hoursExtended time for proper membrane insertion

Purification Strategy:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization using appropriate detergents (DDM, LDAO, or C12E8)

  • Immobilized metal affinity chromatography (IMAC) purification

  • Size exclusion chromatography for final polishing

For storage, the purified protein should be maintained in a Tris-based buffer with 50% glycerol at -20°C, with long-term storage at -80°C. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week . The presence of appropriate detergents is critical throughout the purification process to maintain protein stability and prevent aggregation.

How can researchers investigate the structural determinants of cobalt specificity in CbiM?

Investigating the structural basis of CbiM's cobalt specificity requires multiple complementary approaches:

Site-Directed Mutagenesis Strategy:

  • Identify conserved residues through multiple sequence alignment of CbiM homologs across bacterial species

  • Focus on charged and polar residues within transmembrane domains that may form the ion-binding site

  • Generate single and combinatorial mutations of these residues

  • Assess the impact on cobalt uptake using transport assays or isotope labeling

Structural Analysis Techniques:

  • Cryo-electron microscopy has proven successful for related complexes (as demonstrated with Roseiflexus castenholzii photocomplexes at 2.86 Å resolution)

  • X-ray crystallography of purified CbiM in lipidic cubic phase environments

  • Molecular dynamics simulations to model metal ion interactions within the binding pocket

Metal Binding Assays:

  • Isothermal titration calorimetry (ITC) with purified protein and various metal ions

  • Competition assays to determine relative binding affinities for different divalent cations

  • Spectroscopic approaches (e.g., circular dichroism) to detect conformational changes upon metal binding

Researchers should note that CbiM's specificity likely arises from the precise geometric arrangement of coordinating residues that favor cobalt's ionic radius and coordination chemistry over other divalent metals. Understanding these structural determinants can provide insights into the evolution of metal specificity in ECF transporters .

What evolutionary relationships exist between CbiM and other ECF transporter components?

Phylogenetic analyses of ECF transporters reveal complex evolutionary relationships:

Evolutionary Patterns:

  • The S (CbiM), T (CbiQ), and A (CbiO) subunits of ECF transporters have undergone "extensive shuffling over evolutionary time," although T and A subunits frequently coevolved when encoded separately from S subunits .

  • CbiM shows significant sequence homology with other substrate-binding S components, including BioY (biotin transporters) and ThiW (thiamine transporters), with comparison scores sufficient to establish homology (11.8 standard deviations) .

  • Genomic context analysis shows that in some organisms, the genes encoding these transport components are organized in operons, while in others they may be scattered throughout the genome.

Genomic Context:

  • The gene encoding CbiM (cbiM) in Roseiflexus sp. strain RS-1 is designated as RoseRS_0560 .

  • In many organisms, cbiM is found in close proximity to genes involved in cobalamin biosynthesis and regulation.

  • Riboswitch regulatory sequences often control the expression of ECF transporter genes, providing insights into potential substrates and evolution of these diverse transporters .

The evolutionary analysis suggests that the cobalt transport system components (CbiM, CbiQ, CbiO) share a common ancestor with nickel transporters (NikM, NikQ), which is consistent with the chemical similarities between these transition metals. This evolutionary relationship can be leveraged to predict functional properties of uncharacterized transporters based on sequence homology patterns .

How does genomic context influence cbiM expression and regulation in Roseiflexus species?

The genomic context of cbiM provides crucial insights into its regulation and functional integration with other metabolic pathways:

Regulatory Mechanisms:

  • Cobalamin riboswitches are prevalent regulators of B12-related genes, including cobalt transporters. Analysis of riboswitch distribution reveals that "cobalamin riboswitches primarily regulate enzymes responsible for the synthesis of the corrin ring from uroporphyrinogen-III as well as its subsequent modification into adenosylcobalamin" .

  • Both aerobic and anaerobic pathway enzymes involved in cobalamin synthesis are regulated by these riboswitches, suggesting coordinated expression with cobalt transporters.

  • Genomic studies indicate that cobalamin riboswitches control "a large number of known or predicted cobalt transporters, which are widespread in both bacteria and archaea" .

Comparative Genomics:

  • The Roseiflexus sp. strain RS-1 genome has been completely sequenced, facilitating comparative genomic analyses with other photosynthetic bacteria such as Chloroflexus species .

  • Metagenomic sequences from environmental samples show high similarity (>80% nucleotide identity) to the Roseiflexus sp. strain RS-1 genome, indicating conservation of these transport systems in natural populations .

  • Genome-wide studies of Roseiflexus sp. have identified multiple ECF transporter components, including cobalt transport genes like cbiM, suggesting the importance of metal homeostasis in these organisms .

Understanding the genomic context can inform experiments aimed at manipulating cbiM expression, such as through controlled expression systems or native promoter studies, potentially allowing for enhanced production of recombinant CbiM or engineering of cobalt transport in synthetic biology applications.

What experimental approaches can be used to measure CbiM-mediated cobalt transport in vitro?

Several experimental designs can effectively measure CbiM-mediated cobalt transport:

Reconstituted Proteoliposome Assays:

  • Purify recombinant CbiM along with the complete transport complex (CbiM, CbiQ, CbiO)

  • Reconstitute purified proteins into liposomes with controlled lipid composition

  • Establish a cobalt gradient using radioactive isotopes (57Co, 60Co) or fluorescent cobalt probes

  • Measure time-dependent accumulation of cobalt inside proteoliposomes using:

    • Radioisotope counting for labeled cobalt

    • Fluorescence quenching for fluorescent probes

    • ICP-MS for precise quantification of metal content

Whole-Cell Transport Assays:

  • Express recombinant CbiM system in a host organism lacking endogenous cobalt transporters

  • Expose cells to defined concentrations of cobalt under controlled conditions

  • Measure cellular accumulation of cobalt using analytical techniques

  • Compare wild-type and mutant variants to assess structure-function relationships

Split-Plot Experimental Design:
For complex in vitro transport studies involving multiple factors, a split-plot experimental design is recommended3 . This approach is particularly valuable when:

  • Some factors are difficult to change (hard-to-change factors) while others can be easily manipulated (easy-to-change factors)

  • Multiple measurements must be taken from the same experimental unit

Experimental Design ElementApplication to CbiM Studies
Whole-plot factorsTemperature, pH, membrane composition
Sub-plot factorsCobalt concentration, competing ions, ATP levels
Response variablesTransport rate, binding affinity, ion selectivity

What insights from structural studies of related Roseiflexus proteins can inform CbiM research?

Recent high-resolution structural studies of Roseiflexus proteins provide valuable insights applicable to CbiM research:

Structural Approaches:

  • Cryo-electron microscopy (cryo-EM) has been successfully applied to Roseiflexus castenholzii photocomplexes, achieving resolutions of 2.86 Å, demonstrating the viability of this technique for membrane protein complexes from this genus .

  • Mass spectrometry analyses combined with electron density mapping have enabled unambiguous determination of previously uncertain structural details in Roseiflexus protein complexes .

  • These methods revealed the presence and orientation of small transmembrane polypeptides that were previously misassigned, highlighting the importance of high-resolution structural data for accurate annotation .

Methodological Transferability:
The success of these approaches with photocomplexes suggests similar methods could be applied to the CbiM transport system. Key transferable aspects include:

  • Sample preparation techniques for membrane proteins from Roseiflexus species

  • Detergent selection for protein extraction while maintaining native interactions

  • Cryo-EM grid preparation parameters optimized for Roseiflexus membrane proteins

  • Image processing workflows that effectively deal with the challenges of membrane protein complexes

Researchers working with CbiM can leverage these established methodologies to conduct structural studies of the complete cobalt transport complex, potentially leading to insights into the ion translocation pathway and energetic coupling mechanisms between components.

How can experimental design optimize the investigation of CbiM function in different environmental contexts?

Investigating CbiM function across diverse environmental conditions requires careful experimental design:

Multifactorial Experimental Approach:

  • Implementation of rotational central composite design (RCCD) which "merges statistical and mathematical procedures to model the relationships among independent variables (factors or parameters tested) and dependent variable (response)" .

  • This approach enables testing of combinations of factors at different levels while reducing the total number of experiments required.

  • Relevant factors to test include temperature, pH, ionic strength, redox potential, and presence of competing metal ions.

Environmental Context Considerations:
Roseiflexus species have been isolated from alkaline siliceous hot springs in Yellowstone National Park, indicating adaptation to specific environmental niches . Therefore, researchers should consider:

  • Temperature ranges (known optimum for cultivation: 50°C)

  • pH preferences (alkaline conditions preferred)

  • Sulfide tolerance levels (cultured with approximately 30 μM sulfide)

  • Metal ion availability characteristic of native habitats

Chemometric Analysis Approach:
For complex datasets involving multiple environmental variables, advanced data analysis methods can be valuable:

  • Multiple co-inertia analysis (MCOA) can be applied to data originating from multiple experimental conditions

  • This approach allows detection of which environmental parameters most significantly influence CbiM function

  • Weighted mean and standard deviation calculations can identify key variables driving differences in transport activity

By systematically exploring the parameter space using these experimental design approaches, researchers can identify optimal conditions for CbiM function and gain insights into the adaptive mechanisms that allow Roseiflexus sp. to maintain cobalt homeostasis in its natural habitat.

Citations ELISA Recombinant Roseiflexus sp. Cobalt transport protein CbiM, product information, https://www.colorectalresearch.com/shop/csb-cf403860riq-elisa-recombinant-roseiflexus-sp-cobalt-transport-protein-cbim-cbim-154079 Using a domestic and sexual violence prevention advocate to implement a dating violence prevention program with athletes, Health Education Resources.3 Some Experiences in Modern Experimental Design - Presentation by Marcus Perry, Editor in Chief, Quality Engineering; Professor of Statistics, The University of Alabama. New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of the high-resolution cryo-EM structures of native and Crt-less complexes. ELISA Recombinant Roseiflexus sp. Cobalt transport protein CbiM (cbiM), product details, https://www.vbrc.org/shop/csb-cf403860riq-elisa-recombinant-roseiflexus-sp-cobalt-transport-protein-cbim-cbim-154079 Cultivation and Genomic, Nutritional, and Lipid Biomarker Characterization of Roseiflexus strains. University of California, San Diego dissertation on riboswitch regulatory sequences regulating expression of ECF transporter genes. Coaching Boys Into Men (CBIM) research-tested ARA/SV prevention program. Experimental design and chemometric techniques applied in electronic nose analysis. The Transporter Classification Database: Dynamic interactions of CbiN and CbiM trigger activity of a cobalt energy-coupling-factor transporter. Making the Case: Top 10 Questions from Coaches About CBIM. Environmental genomics reveals information about cobalt transport systems in bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.