Recombinant Roseiflexus sp. Glycerol-3-phosphate acyltransferase (plsY)

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its biochemical function?

Glycerol-3-phosphate acyltransferase (plsY) is an essential enzyme in bacterial phospholipid biosynthesis that catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate. This reaction represents the first committed step in the synthesis of membrane phospholipids. In Roseiflexus sp. (strain RS-1), plsY is encoded by the gene plsY (ordered locus name: RoseRS_3809) and functions as an acyl-phosphate--glycerol-3-phosphate acyltransferase (EC 2.3.1.n3) . The enzyme is alternatively known as Acyl-PO4 G3P acyltransferase or GPAT (Glycerol-3-Phosphate AcylTransferase) . The biochemical role of plsY is particularly significant in thermophilic bacteria like Roseiflexus, which must maintain membrane integrity under extreme temperature conditions.

What structural characteristics define Roseiflexus sp. plsY?

Roseiflexus sp. (strain RS-1) plsY is a membrane-associated protein consisting of 203 amino acids as indicated by its expression region (1-203) . The protein sequence (UniProt accession: A5UZW0) reveals a hydrophobic profile consistent with multiple transmembrane domains, as evidenced by its amino acid composition: MMPTIASIALVLLAYLSGSIPFSLLVARAWGVDLRVSGSGNVGAANVWRTCGFSAFALAMGGDMLKGALPTIAAQALGLSPLAVVIVGTAAMLGHTRSIFLGFRGGKAVATGGGVVLTLAPLVALPGLAAWAVTFGITRISAVASLTA AAAVCGIAAAVLLALGMLPPAYAIFVWGAVAAIVFLHRSNIHRLRTGTENRFEKLF . Structural analysis suggests that plsY likely adopts a configuration where catalytic domains are positioned to interact with both the cytoplasmic and membrane phases, facilitating access to both the water-soluble glycerol-3-phosphate and lipid-soluble acyl substrates.

How does Roseiflexus sp. plsY differ from homologous enzymes in other bacteria?

Roseiflexus sp. plsY represents a distinct evolutionary adaptation to thermophilic environments. Unlike mesophilic bacterial homologs, this enzyme has evolved to maintain stability and function at elevated temperatures, as Roseiflexus species are typically found in alkaline siliceous hot springs in locations such as Yellowstone National Park . Comparative sequence analysis with other bacterial plsY proteins reveals adaptations that likely contribute to thermostability, including higher proportion of hydrophobic residues and potential salt bridge formations. Additionally, as a protein from filamentous anoxygenic phototrophs (FAPs), Roseiflexus sp. plsY may have specialized roles related to photosynthetic membrane organization that differentiate it from enzymes in non-photosynthetic bacteria.

What is the ecological and evolutionary significance of studying plsY from thermophilic photosynthetic bacteria?

Studying plsY from Roseiflexus sp. provides valuable insights into molecular adaptations to extreme environments and the evolution of photosynthetic systems. Roseiflexus represents one of the deepest branches of photosynthetic bacteria , making it an excellent model for understanding the evolutionary development of photosynthesis and membrane biogenesis. These bacteria thrive in hot springs at elevated temperatures and represent an important component of microbial mat communities . Research on plsY contributes to our understanding of how phospholipid biosynthesis has adapted to support photosynthetic membranes in thermophilic environments, offering evolutionary insights into the diversification of metabolic pathways across bacterial lineages.

What are the optimal conditions for storage and handling of recombinant Roseiflexus sp. plsY?

Recombinant Roseiflexus sp. plsY should be stored at -20°C, with extended storage recommended at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for stability . For experimental use, it is advised to prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended and may lead to protein degradation and activity loss . When handling the protein, maintain sterile conditions and use low-retention pipette tips to minimize protein loss due to adherence. For experiments requiring longer incubation times, consider the addition of protease inhibitors to prevent degradation.

What expression systems are most effective for producing functional recombinant Roseiflexus sp. plsY?

Based on current research protocols for thermophilic proteins, effective expression systems for Roseiflexus sp. plsY include:

For optimal expression, consider using a construct with an N-terminal His-tag for purification purposes, while ensuring that the tag doesn't interfere with membrane association or enzymatic activity. Induction parameters should be carefully optimized, with lower temperatures (15-25°C) during induction potentially improving the solubility and correct folding of the recombinant protein. Given that plsY is a membrane-associated enzyme, expression protocols that facilitate proper membrane integration or inclusion of mild detergents in lysis buffers may improve recovery of functional protein.

How can enzymatic activity of Roseiflexus sp. plsY be measured in vitro?

The enzymatic activity of Roseiflexus sp. plsY can be measured through several complementary approaches:

• Radiometric assay: Utilizing radiolabeled substrates (either [14C]-glycerol-3-phosphate or [14C]-acyl phosphate) and quantifying the formation of radiolabeled lysophosphatidic acid via thin-layer chromatography or scintillation counting.

• Coupled enzyme assay: Measuring the release of inorganic phosphate during acyl transfer using colorimetric methods such as malachite green assay.

• Mass spectrometry-based assay: Detecting and quantifying the formation of lysophosphatidic acid product using LC-MS/MS.

For thermophilic enzymes like Roseiflexus sp. plsY, it is crucial to conduct activity assays at physiologically relevant temperatures (typically 50-70°C). The reaction buffer should mimic the alkaline conditions of the native hot spring environment (pH 8.0-9.0) and include appropriate divalent cations (Mg2+ or Mn2+) that may serve as cofactors. Control reactions without enzyme or with heat-inactivated enzyme should be included to distinguish enzymatic activity from non-enzymatic acyl transfer.

What purification strategies yield the highest activity for recombinant plsY?

Effective purification strategies for recombinant Roseiflexus sp. plsY must address its membrane-associated nature while preserving enzymatic activity:

Throughout purification, it is essential to include glycerol (10-20%) in buffers to maintain protein stability and prevent aggregation. For thermostable enzymes like Roseiflexus sp. plsY, performing chromatography steps at elevated temperatures (30-40°C) may improve folding and activity. Enzymatic activity should be monitored at each purification step to identify conditions that preserve function. The final purified protein should be stored in a buffer containing 50% glycerol as indicated in the product specifications .

What is the relationship between plsY structure and thermal stability in Roseiflexus sp.?

Roseiflexus species thrive in hot spring environments with temperatures typically ranging from 45-70°C . This thermophilic lifestyle necessitates adaptations in all cellular components, including membrane-associated enzymes like plsY. The integration of plsY into the membrane architecture of Roseiflexus may also contribute to its thermal stability, as the membrane environment itself undergoes adaptations (such as increased saturation of fatty acids) in response to high temperatures.

How do substrate specificity and catalytic mechanism of Roseiflexus sp. plsY compare to other acyltransferases?

Roseiflexus sp. plsY likely exhibits distinctive substrate preferences adapted to the lipid composition of thermophilic photosynthetic membranes. While the core catalytic mechanism involving acyl transfer from acyl-phosphate to glycerol-3-phosphate is conserved across bacterial plsY enzymes, specific residues within the active site determine acyl chain selectivity. The conserved motifs for substrate binding can be identified within the amino acid sequence, particularly in regions rich in charged and polar residues .

As a thermophilic organism associated with photosynthetic functions, Roseiflexus sp. likely requires specialized membrane compositions to support both thermal stability and photosynthetic machinery. This would be reflected in the substrate specificity of plsY, potentially favoring certain acyl chain lengths or degrees of saturation that contribute to appropriate membrane fluidity at high temperatures. Comparative analysis with mesophilic homologs would reveal adaptations in the substrate-binding pocket that accommodate these specialized requirements.

What functional domains are present in Roseiflexus sp. plsY and how do they interact with membrane environments?

Based on sequence analysis and comparison with other acyltransferases, Roseiflexus sp. plsY likely contains several functional domains:

• Transmembrane domains: Multiple hydrophobic regions that anchor the protein in the membrane, as evidenced by the hydrophobic stretches in the amino acid sequence .

• Acyl-phosphate binding domain: Specific residues that coordinate the acyl-phosphate substrate, likely involving conserved basic amino acids that interact with the phosphate group.

• Glycerol-3-phosphate binding domain: A pocket that positions glycerol-3-phosphate for nucleophilic attack on the acyl-phosphate.

• Catalytic residues: Specific amino acids that facilitate the transfer reaction, potentially including histidine, serine, or aspartate residues that activate the glycerol-3-phosphate hydroxyl group.

The interaction of these domains with the membrane is critical for enzyme function. The transmembrane regions position the catalytic site at the membrane-cytoplasm interface, allowing access to both the water-soluble glycerol-3-phosphate and the more hydrophobic acyl-phosphate substrate. This positioning facilitates the incorporation of the newly formed lysophosphatidic acid directly into the membrane bilayer.

How might plsY function be integrated into the photosynthetic machinery of Roseiflexus?

In Roseiflexus species, which are filamentous anoxygenic phototrophs lacking chlorosomes , plsY likely plays a crucial role in the development and maintenance of specialized photosynthetic membranes. The reaction center-light harvesting (RC-LH) complexes in Roseiflexus require specific lipid environments for optimal function . As the enzyme catalyzing the first committed step in phospholipid biosynthesis, plsY would directly influence membrane composition and organization.

Roseiflexus castenholzii, a related species, has been shown to contain bacteriochlorophyll a (but not bacteriochlorophyll c) and forms distinctive RC-LH complexes . The proper assembly and function of these complexes depend on appropriate membrane architecture. plsY activity may be regulated in response to light conditions or growth phase to adjust membrane composition, as suggested by the observation that Roseiflexus can grow photoheterotrophically or chemoheterotrophically under different conditions . This functional integration highlights the importance of studying plsY in the context of photosynthetic membrane specialization.

How can structural insights from Roseiflexus sp. plsY inform protein engineering of acyltransferases?

Structural knowledge of Roseiflexus sp. plsY offers valuable templates for engineering thermostable acyltransferases with novel properties. The amino acid sequence contains information about thermostable motifs that could be transferred to mesophilic homologs to enhance their stability . Key engineering targets include:

• Substrate specificity determinants: Residues that interact with the acyl chain could be modified to alter chain length preferences or accommodate non-natural substrates.

• Catalytic efficiency elements: Amino acids in the active site that influence reaction rates could be optimized for industrial applications requiring faster turnover.

• Thermostability features: Structural elements contributing to high-temperature stability could be identified and incorporated into less stable enzymes.

• Membrane interaction domains: Modifications to transmembrane regions could alter membrane association properties for specific applications.

Comparative analysis between Roseiflexus sp. plsY and homologs from diverse bacteria would reveal conserved catalytic residues versus variable regions that determine specific functional properties. This information guides rational design approaches for creating engineered enzymes with tailored activities for biotechnological applications, particularly those requiring function under extreme conditions.

What role might plsY play in the adaptation of Roseiflexus sp. to high-temperature environments?

The adaptation of Roseiflexus sp. to high-temperature environments involves comprehensive adjustments to cellular machinery, with plsY playing a crucial role in membrane adaptation. In hot spring environments like those in Yellowstone National Park , membrane fluidity must be precisely regulated to maintain integrity while allowing sufficient flexibility for membrane protein function. plsY likely contributes to this adaptation through:

• Synthesis of lysophosphatidic acid with acyl chains appropriate for thermophilic membranes, potentially favoring more saturated fatty acids that increase membrane stability at high temperatures.

• Adjustment of membrane lipid composition in response to temperature fluctuations, potentially through temperature-dependent changes in enzyme activity or substrate preference.

• Support for the specialized membrane requirements of thermophilic photosynthetic machinery, as Roseiflexus contains distinctive photosynthetic complexes that function optimally within specific lipid environments .

• Maintenance of appropriate membrane properties for filamentous growth, as Roseiflexus species form filamentous structures that require coordinated membrane biogenesis .

Understanding plsY's role in these adaptations provides insights into the molecular basis of thermophily and the evolution of extremophile metabolism.

How can recombinant Roseiflexus sp. plsY be utilized in studies of membrane biogenesis in thermophilic bacteria?

Recombinant Roseiflexus sp. plsY serves as a valuable tool for investigating membrane biogenesis in thermophilic bacteria through several experimental approaches:

These approaches can reveal how plsY activity coordinates with other membrane biogenesis pathways in thermophilic contexts. For instance, the enzyme's role in generating precursors for specialized photosynthetic membranes could be examined by reconstituting portions of the lipid biosynthesis pathway in vitro. Additionally, the interaction between plsY activity and the assembly of photosynthetic complexes could be studied using recombinant protein to supplement membrane fractions from Roseiflexus or related phototrophs.

What are the current challenges in understanding the regulatory mechanisms of plsY in Roseiflexus sp.?

Several challenges complicate the study of regulatory mechanisms controlling plsY in Roseiflexus sp.:

• Limited genetic tools: Compared to model organisms, genetic manipulation of Roseiflexus species remains challenging, hindering in vivo studies of regulation.

• Complex growth requirements: Roseiflexus species require specific cultivation conditions, including appropriate light and temperature, complicating experiments examining regulation under different growth conditions .

• Integration with photosynthetic metabolism: The regulatory connections between phospholipid synthesis and photosynthetic processes remain poorly understood, particularly how light availability affects plsY expression or activity.

• Post-translational modifications: Potential regulatory modifications of plsY that might affect its activity or localization in response to environmental cues are largely unexplored.

• Membrane microdomain association: How plsY might associate with specific membrane regions, particularly in proximity to photosynthetic complexes, represents an open question in understanding spatial regulation of its activity.

Addressing these challenges requires integrative approaches combining biochemical characterization of the recombinant enzyme with systems biology techniques to place plsY function in the broader context of cellular metabolism in thermophilic phototrophs.

What are common challenges in obtaining active recombinant plsY and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Roseiflexus sp. plsY:

• Inclusion body formation: As a membrane protein, plsY often aggregates in heterologous expression systems. This can be mitigated by:

  • Lowering induction temperature (15-18°C)

  • Using specialized strains designed for membrane protein expression

  • Adding solubilizing agents like glycerol (5-10%) to growth media

  • Employing fusion partners that enhance solubility (MBP, SUMO)

• Low enzymatic activity: Recombinant plsY may show reduced activity compared to native enzyme due to:

  • Improper folding or missing post-translational modifications

  • Suboptimal detergent selection during purification

  • Loss of essential lipid cofactors during purification

  Solution: Screen multiple detergents at various concentrations; consider adding phospholipids during purification to maintain a native-like environment.

• Stability issues: Thermophilic proteins may paradoxically show stability problems when expressed at lower temperatures:

  • Store in buffer containing 50% glycerol as recommended

  • Add reducing agents to prevent oxidation of cysteine residues

  • Consider chemical chaperones to stabilize protein structure

Each of these challenges requires systematic optimization of expression and purification conditions, with activity assays at each step to guide protocol refinement.

How can researchers resolve discrepancies in activity measurements of plsY across different experimental conditions?

Discrepancies in plsY activity measurements often stem from variation in experimental conditions. To resolve such discrepancies:

• Standardize assay conditions:

  • Maintain consistent temperature (preferably reflecting the thermophilic nature of Roseiflexus)

  • Use defined buffer compositions with controlled pH (8.0-9.0 for optimal activity)

  • Ensure consistent substrate concentrations and quality

  • Control for batch-to-batch variation in enzyme preparations

• Account for detergent effects:

  • Different detergents can dramatically affect enzyme activity

  • Create a standardized curve of activity versus detergent concentration

  • Report detergent:protein ratios in methods sections

• Implement internal standards:

  • Include a well-characterized enzyme preparation as a reference in each experiment

  • Express activity as relative values compared to this standard

• Control for substrate accessibility:

  • When using membrane-incorporated substrates, ensure consistent presentation

  • Consider mixed micelle or liposome systems for more native-like substrate presentation

By systematically addressing these factors and thoroughly documenting experimental conditions, researchers can identify the source of discrepancies and establish reproducible activity measurements for Roseiflexus sp. plsY.

What control experiments are essential when studying plsY activity in relation to photosynthetic membrane function?

When investigating plsY activity in relation to photosynthetic membrane function, several critical controls must be included:

• Temperature controls:

  • Perform parallel experiments at physiological temperature for Roseiflexus (50-70°C) and standard laboratory temperature

  • Include temperature ramp experiments to determine optimal activity range

• Light condition controls:

  • Compare enzyme activity under dark and illuminated conditions

  • Test specific wavelengths relevant to bacteriochlorophyll a absorption (800 nm and 880 nm)

  • Include controls for potential photochemical effects on substrates

• Membrane environment controls:

  • Compare activity in detergent micelles versus reconstituted liposomes

  • Vary lipid composition to mimic native versus non-native membrane environments

  • Include membrane fractions from non-photosynthetic bacteria as negative controls

• Substrate specificity controls:

  • Test multiple acyl-phosphate donors with varying chain lengths and saturation

  • Compare natural versus synthetic substrate analogs

  • Include competition assays to determine relative substrate preferences

These controls help distinguish direct effects on plsY activity from indirect effects mediated through changes in membrane properties or photosynthetic function, enabling more accurate interpretation of experimental results.

How can researchers distinguish between direct and indirect effects when manipulating plsY in vivo?

Distinguishing direct from indirect effects when manipulating plsY in vivo represents a significant challenge, especially in a complex system like photosynthetic membranes. Researchers should employ the following strategies:

• Complementary in vitro and in vivo approaches:

  • Perform parallel experiments with purified enzyme and whole cells

  • Use reconstituted systems of increasing complexity to bridge the gap between in vitro simplicity and in vivo complexity

• Targeted mutagenesis:

  • Create point mutations affecting specific aspects of enzyme function (catalytic activity, membrane binding, etc.)

  • Compare phenotypes of catalytically inactive versus binding-deficient mutants

• Temporal analysis:

  • Monitor changes over time after perturbation

  • Direct effects typically occur more rapidly than downstream indirect effects

  • Use pulse-chase experiments to track metabolic flow through the pathway

• Multi-omics integration:

  • Combine lipidomics, proteomics, and transcriptomics approaches

  • Map changes across multiple cellular systems to distinguish primary from secondary effects

  • Look for coordinated changes in related pathways that suggest regulatory networks

• Inhibitor studies:

  • Use specific inhibitors of plsY versus other pathway components

  • Compare kinetics and magnitude of effects across different targets

These approaches, used in combination, provide a framework for disentangling the complex relationships between plsY activity and broader cellular functions in Roseiflexus sp.

What emerging technologies could advance our understanding of plsY function in thermophilic photosynthetic bacteria?

Several cutting-edge technologies hold promise for deepening our understanding of plsY function in Roseiflexus sp.:

• Cryo-electron microscopy:

  • Determine high-resolution structures of plsY in membrane environments

  • Visualize interactions with other components of lipid biosynthesis machinery

  • Examine integration with photosynthetic complexes

• Advanced genetic tools for thermophiles:

  • CRISPR-Cas9 systems optimized for thermophilic organisms

  • Inducible expression systems for controlled manipulation of plsY levels

  • Reporter systems functional at high temperatures

• Single-molecule enzymology:

  • Direct observation of plsY catalytic cycles using fluorescently labeled substrates

  • Measurement of kinetic parameters under near-native conditions

  • Detection of conformational changes during catalysis

• Synthetic biology approaches:

  • Minimal reconstituted systems incorporating plsY and related enzymes

  • Designer membranes with controlled composition for systematic study of lipid effects

  • Cell-free expression systems optimized for thermophilic proteins

These technologies, particularly when used in combination, could overcome current limitations in studying this challenging but important enzyme from thermophilic photosynthetic bacteria.

How might computational approaches enhance our understanding of plsY evolution and function?

Computational approaches offer powerful tools for investigating plsY evolution and function:

• Molecular dynamics simulations:

  • Model plsY behavior in membranes at elevated temperatures

  • Identify conformational changes associated with catalysis

  • Predict effects of mutations on stability and activity

• Comparative genomics and phylogenetics:

  • Trace the evolutionary history of plsY across thermophilic and mesophilic lineages

  • Identify conserved residues indicating functional importance

  • Discover potential horizontal gene transfer events

• Metabolic modeling:

  • Integrate plsY into genome-scale metabolic models of Roseiflexus

  • Predict systems-level effects of altered plsY activity

  • Identify potential regulatory relationships with photosynthetic pathways

• Machine learning approaches:

  • Develop predictive models for substrate specificity based on protein sequence

  • Identify patterns in gene expression data related to plsY regulation

  • Discover novel relationships between plsY and other cellular systems

These computational approaches complement experimental methods and can guide hypothesis generation for targeted experimental validation, accelerating the pace of discovery regarding this important enzyme.

What are the key takeaways for researchers working with Recombinant Roseiflexus sp. plsY?

Researchers working with Recombinant Roseiflexus sp. Glycerol-3-phosphate acyltransferase (plsY) should consider several critical factors to ensure successful experiments. The enzyme's thermophilic origin necessitates special consideration for temperature conditions during activity assays and storage . Optimal storage in Tris-based buffer with 50% glycerol at -20°C or -80°C preserves activity, while working aliquots should be maintained at 4°C for no more than one week . The membrane-associated nature of plsY requires careful selection of detergents or reconstitution systems to maintain a suitable lipid environment for activity.

The dual physiological roles of plsY in both basic membrane lipid biosynthesis and supporting specialized photosynthetic machinery make it an excellent model for studying the integration of these processes in thermophilic bacteria. Researchers should design experiments that consider both these aspects, particularly when investigating regulatory mechanisms or environmental responses. Finally, integration of biochemical, structural, and systems biology approaches will yield the most comprehensive understanding of this fascinating enzyme from an evolutionarily distinct branch of photosynthetic bacteria.

What interdisciplinary connections can be made through research on Roseiflexus sp. plsY?

Research on Roseiflexus sp. plsY creates valuable connections across multiple scientific disciplines:

• Evolutionary biology and extremophile adaptation:

  • Understanding how essential enzymes like plsY have evolved to function in extreme environments

  • Tracing the evolution of photosynthetic machinery across phylogenetic lineages

• Membrane biochemistry and biophysics:

  • Elucidating the relationship between lipid composition and membrane protein function

  • Investigating how membrane properties adapt to extreme temperatures

• Synthetic biology and protein engineering:

  • Applying insights from thermostable enzymes to design robust biosynthetic systems

  • Developing new biocatalysts for high-temperature industrial processes

• Environmental microbiology and ecology:

  • Understanding the metabolic capabilities that allow Roseiflexus to thrive in hot spring microbial communities

  • Investigating nutrient cycling in extreme environments

• Structural biology and enzymology:

  • Revealing mechanisms of thermostability in membrane-associated enzymes

  • Advancing our understanding of acyltransferase catalytic mechanisms