Recombinant Roseiflexus sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mscL; RoseRS_2342; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Roseiflexus sp. (strain RS-1)
Target Names
mscL
Target Protein Sequence
MFEGFKTFVMRGNVIDLAVGVVIGTAFSAVVNSLVNDILMAIVATLIGQPDFSDVLVFGA VRLGAFITTIVNFLIISAALYFLVVVPINKLSEFTRRNEPPPAPPAPSAEEKLLTEIRDL LRQNIT
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Roseiflexus sp. and what are its key characteristics?

Roseiflexus sp. is a thermophilic, filamentous anoxygenic phototroph belonging to the phylum Chloroflexi. Roseiflexus castenholzii, a specific species of this genus, forms unbranched multicellular filaments with cell diameters of 0.8-1.0 μm and creates distinct red bacterial mats in its natural environment . These organisms are notable for their ability to grow both photoheterotrophically under anaerobic light conditions and chemoheterotrophically under aerobic dark conditions .

Key characteristics of Roseiflexus sp. include:

  • Optimal growth at 50°C and pH 7.5-8.0

  • Contains bacteriochlorophyll a and γ-carotene derivatives as photosynthetic pigments

  • Lacks bacteriochlorophyll c and chlorosomes (unlike Chloroflexus aurantiacus)

  • Major cellular fatty acids are C16:0, C14:0, and C15:0

  • Primary quinone is menaquinone-11

  • DNA G+C content of 62.0 mol%

  • Possesses pheophytin-quinone-containing Type II reaction centers and membrane-bound bacteriochlorophyll a-containing light-harvesting complexes

Roseiflexus species inhabit various aquatic and mat habitats, with significant populations found in alkaline siliceous hot springs in Yellowstone National Park .

What is the physiological role of the Large-conductance mechanosensitive channel (mscL) in bacteria?

The Large-conductance mechanosensitive channel (mscL) functions as a critical emergency release valve in bacteria, discharging cytoplasmic solutes when the cell experiences decreased osmotic pressure in the environment . This protective mechanism helps prevent cell lysis during osmotic downshock.

MscL is one of the largest pores found in nature, with a diameter exceeding 25 Å when open, allowing the passage of large organic ions and small proteins . This substantial pore size enables rapid release of cellular contents when necessary to maintain membrane integrity.

The channel contains several important structural and functional features that are conserved across species:

  • The ability to directly sense and respond to biophysical changes in the membrane

  • An α-helix ("slide helix") or series of charges at the cytoplasmic membrane boundary that guide transmembrane movements

  • Critical subunit interfaces that, when disrupted, can cause inappropriate channel gating

While the specific role of mscL in Roseiflexus sp. hasn't been extensively characterized, it likely serves the same protective function during osmotic stress as described for bacterial mscL channels in general.

What experimental design approaches are most effective for expressing recombinant mscL from Roseiflexus sp.?

Optimizing the expression of recombinant Roseiflexus sp. mscL requires a systematic experimental design approach. Factorial designs have proven successful for optimizing bioprocesses and protein expression, allowing researchers to efficiently determine optimal conditions with minimal experiments .

The statistical experimental design methodology offers significant advantages over traditional univariate approaches by:

  • Evaluating multiple variables simultaneously

  • Identifying statistically significant variables and their interactions

  • Characterizing experimental error

  • Normalizing variables for comparing effects

  • Obtaining high-quality information with fewer experiments

For recombinant mscL expression, a fractional factorial screening design is recommended, using two levels for each variable and replicas at the central point . Key variables to consider include:

Variable CategorySpecific Factors
Induction ConditionsTemperature, induction time, inducer concentration
Media CompositionCarbon source, nitrogen source, salt concentration
Host StrainE. coli variants optimized for membrane protein expression
Expression ParametersOD600 at induction, post-induction growth time

When designing your expression system, consider that induction times between 4-6 hours have shown similar levels of productivity for some membrane proteins, with longer induction times (>6h) associated with lower productivity . The Roseiflexus sp. mscL expression region encompasses amino acids 1-126, representing the full-length protein .

What are the optimal conditions for purifying and storing recombinant Roseiflexus sp. mscL protein?

Based on established protocols for recombinant Roseiflexus sp. mscL, the following storage conditions are recommended:

Storage Buffer: Tris-based buffer with 50% glycerol, optimized specifically for mscL protein stability

Storage Temperature Guidelines:

  • Short-term storage: -20°C

  • Extended storage: -20°C or -80°C

  • Working aliquots: 4°C for up to one week

Important Considerations:

  • Repeated freezing and thawing should be avoided as it can compromise protein integrity

  • The tag type for purification should be determined during the production process based on specific experimental needs

While specific purification protocols for Roseiflexus sp. mscL must be optimized for each laboratory setting, the general workflow for membrane protein purification typically includes:

  • Cell lysis using appropriate methods that preserve protein structure

  • Isolation of the membrane fraction through ultracentrifugation

  • Solubilization with detergents suitable for membrane proteins

  • Affinity chromatography utilizing appropriate tags

  • Further purification by size exclusion or ion exchange chromatography if needed

How can factorial design enhance the optimization of recombinant mscL expression and characterization?

Factorial design experiments offer a powerful approach to systematically optimize recombinant mscL expression and characterization. This methodology allows researchers to identify optimal conditions while efficiently using resources and providing statistical validation .

A typical factorial design approach for mscL optimization would involve:

  • Identifying key variables: Typically using a 2^k factorial design, where k is the number of factors being analyzed, with high (+1) and low (-1) levels for each factor .

  • Designing the experiment: For example, with four factors, the design would include 2^4 = 16 different combinations, potentially performed in duplicate for statistical robustness .

  • Measuring multiple responses: For mscL, relevant response variables include:

    • Cell growth (biomass production)

    • Total protein yield

    • Soluble protein fraction

    • Biological activity of the recombinant protein

  • Analyzing interactions: The multivariant approach reveals interactions between variables that might be missed with univariate methods .

  • Progressive optimization: After initial screening, response surface designs such as the Box-Behnken design (BBD) can be used for further optimization: N = 2k(k−1) + C0, where k is the number of factors .

This approach is particularly valuable for membrane proteins like mscL, which are often challenging to express in functional form. By systematically analyzing variables and their interactions, researchers can identify optimal conditions that maximize both yield and function.

How can researchers utilize mscL channels for controlled delivery of bioactive molecules?

The large pore size of mscL (>25 Å diameter) makes it an excellent candidate for controlled delivery of bioactive molecules into cells. Functional expression of mscL in mammalian cells has been demonstrated to enable rapid, controlled uptake of membrane-impermeable molecules .

A methodological approach for utilizing mscL for molecular delivery involves:

  • Functional expression in target cells: Express mscL channels in mammalian cell membranes using optimized transfection protocols

  • Verification of mechanosensitivity: Ensure that mscL gating in response to increased membrane tension is preserved in the heterologous system

  • Controlled activation: Utilize established methods of charge-induced activation to control mscL opening

  • Molecular delivery: Introduce membrane-impermeable bioactive molecules, such as the bi-cyclic peptide phalloidin (a specific marker for actin filaments)

  • Functional assessment: Evaluate the successful delivery of molecules by assessing their biological activity within the cells

This approach offers several advantages over traditional delivery methods:

  • Spatial and temporal control over molecular delivery

  • Ability to deliver a wide range of molecules, including those that cannot cross the cell membrane naturally

  • Potential for targeted delivery to specific cell types

The biomedical applications of this technology are significant, as "the modality of the MscL channel can be changed, suggesting its use as a triggered nanovalve in nanodevices, including those for drug targeting" .

How do mutations in stem-loop structures affect gene expression of proteins like mscL in Roseiflexus sp.?

While not directly related to mscL protein function, research on Roseiflexus has revealed interesting mechanisms involving RNA stem-loop structures that can affect gene expression. One study identified productive mRNA stem loop-mediated transcriptional slippage in Roseiflexus insertion sequence (IS) elements .

The researchers discovered that stem loop formation can mediate RNA-DNA hybrid realignment on the heteropolymeric sequence T5C5, yielding transcripts lacking a C residue within a corresponding U5C4 sequence. This transcriptional slippage is required for transposase synthesis in the Roseiflexus IS element .

Critical factors affecting this stem loop-mediated slippage include:

  • Stability of the RNA structure

  • Proximity of the stem loop to the slippage site

  • Length and composition of the slippage site motif

  • Identity of 3' adjacent nucleotides

This mechanism resembles hairpin-dependent transcription termination in many respects. The researchers proposed a mechanical slippage model where the RNA polymerase translocation state serves as the main factor determining slippage directionality and efficiency .

While this mechanism hasn't been specifically studied in relation to mscL expression, it represents a potential regulatory mechanism that could affect gene expression in Roseiflexus sp. and might be relevant for understanding the expression of membrane proteins like mscL in these organisms.

What transfection methodologies are most effective for studying mscL in heterologous systems?

Optimizing transfection protocols is crucial for successful expression of mscL in heterologous systems. A systematic approach called "Design of Transfections" (DoT) has been developed to create effective, standardized, and reproducible cell transfection procedures suitable for different cell types and transfection reagents .

The DoT workflow involves:

  • Setting up the experimental framework:

    • Identify the cell line and nucleic acid to transfect

    • Establish a reference protocol as a starting point

    • Identify key variables to optimize

  • Applying factorial design:

    • Implement a 2^k factorial design (where k is the number of factors)

    • Test high (+1) and low (-1) levels for each factor

    • With four factors, this would include 16 different combinations

  • Selecting appropriate factors:

    • The choice of factor levels is crucial - too narrow an interval prevents comprehensive analysis, while too wide an interval may introduce nonlinear effects

    • Preliminary experiments may be necessary to identify appropriate ranges that maintain cell viability

  • Further optimization:

    • Use response surface designs such as Box-Behnken design for fine-tuning

    • The number of combinations to test follows N = 2k(k−1) + C0, where k is the number of factors

For neural progenitors, a specific protocol using linear polyethyleneimine (PEI) has been developed through this approach, which could serve as a starting point for heterologous expression of mscL .

When expressing mechanosensitive channels like mscL, additional considerations include:

  • Selection of expression vectors with appropriate promoters

  • Codon optimization for the host system

  • Addition of fluorescent tags for localization studies

  • Consideration of membrane composition in the heterologous system

How can researchers assess the functional properties of recombinant Roseiflexus sp. mscL?

Assessing the functional properties of recombinant Roseiflexus sp. mscL requires specialized techniques that can measure channel activity, gating properties, and molecular transport. Based on the available literature, several approaches are recommended:

  • Electrophysiological characterization:

    • Patch-clamp recordings to measure channel conductance (reported to be 3.6 nS for bacterial MscL channels)

    • Reconstitution into lipid bilayers for controlled application of membrane tension

    • Analysis of gating kinetics under varying conditions

  • Molecular transport assays:

    • Measuring uptake of fluorescently labeled molecules of varying sizes

    • Using cell-impermeable markers like phalloidin to assess channel opening

    • Quantifying movement of ions or small molecules across membranes

  • Structural assessment:

    • Circular dichroism to evaluate secondary structure

    • Crosslinking studies to examine subunit arrangement

    • Fluorescence resonance energy transfer (FRET) to measure conformational changes during gating

  • Lipid interaction studies:

    • Varying lipid composition to assess effects on channel sensitivity

    • Measuring activation thresholds in different membrane environments

    • Testing temperature dependence, particularly relevant for a thermophilic organism like Roseiflexus

  • Specific activity measurements:

    • Osmotic shock survival assays

    • Patch fluorometry to simultaneously measure structural changes and channel currents

    • Single-molecule force spectroscopy to measure tension requirements for channel opening

Since Roseiflexus sp. is a thermophilic organism, it's particularly important to assess how temperature affects channel function, comparing activity at ambient temperatures versus the organism's optimal growth temperature of 50°C .

What are the challenges in interpreting contradictory data regarding mscL function across different experimental systems?

Researchers studying recombinant Roseiflexus sp. mscL may encounter seemingly contradictory results across different experimental setups. Understanding the sources of these discrepancies is essential for proper data interpretation. Several factors can contribute to experimental variability:

To address these challenges, researchers should:

  • Document experimental conditions comprehensively

  • Utilize multiple complementary techniques to assess channel function

  • Compare results across different expression systems

  • Consider the native environment of Roseiflexus sp. when interpreting results

  • Apply robust statistical methods like those outlined in factorial design approaches

How should researchers approach experimental design for studying mechanosensitive channels like mscL?

Designing experiments for mechanosensitive channel research requires careful consideration of multiple factors. The following systematic approach is recommended based on established experimental design principles:

  • Define experimental units clearly:

    • "For conducting an experiment, the experimental material is divided into smaller parts and each part is referred to as an experimental unit"

    • "The experimental unit is randomly assigned to treatment"

  • Identify key variables and treatments:

    • Distinguish between fixed factors (all levels of interest included) and random factors (levels randomly chosen from all possible levels)

    • For mscL, consider membrane composition, temperature, osmotic conditions, and protein variants as potential factors

  • Implement appropriate replication:

    • "Replication is the repetition of the experimental situation by replicating the experimental unit"

    • Ensure sufficient replication to achieve statistical power while maintaining experimental feasibility

  • Consider specialized designs:

    • Randomized Complete Block Design (RBD) - useful when experimental units can be grouped into blocks

    • Latin Square Design (LSD) - "the experimental material is divided into rows and columns, each having the same number of experimental units"

    • These designs can help control for variables like batch effects or temporal variations

  • Plan for data analysis from the outset:

    • "The designing of the experiment and the analysis of obtained data are inseparable"

    • "If the experiment is designed properly keeping in mind the question, then the data generated is valid and proper analysis of data provides the valid statistical inferences"

A particularly effective approach for mscL research is factorial design, where:

  • Multiple variables are tested simultaneously

  • Interactions between variables can be detected

  • Resource usage is optimized

  • Statistical validity is maintained

For example, a 2^4 factorial design (16 experimental conditions) could examine the effects of temperature, membrane composition, pH, and osmotic pressure on mscL function, revealing not only individual effects but also important interactions between these factors .

How does Roseiflexus sp. differ from other phototrophic bacteria in terms of membrane composition and protein characteristics?

Roseiflexus sp. exhibits several distinctive features compared to other phototrophic bacteria, particularly Chloroflexus aurantiacus, which has important implications for membrane proteins like mscL:

Photosynthetic Apparatus:

  • Roseiflexus sp. lacks chlorosomes and does not synthesize bacteriochlorophyll c, unlike Chloroflexus aurantiacus

  • Contains only bacteriochlorophyll a and γ-carotene derivatives as photosynthetic pigments

  • Forms a unique RC-LH (reaction center-light harvesting) complex that "structurally resembles RC-LH1 but has spectroscopic characteristics similar to the peripheral LH2 of purple bacteria"

Phylogenetic Distinctiveness:

  • Belongs to the anoxygenic filamentous phototrophic bacteria but is "clearly distant from all members in this group"

  • Sequence similarities between Roseiflexus and its relatives are less than 83.8%

  • Forms "the deepest branch of photosynthetic bacteria"

Lipid Composition:

  • Produces C37 to C40 normal wax esters and glycosides

  • Synthesizes distinctive fatty glycosides "consisting of an alkane-1-ol-2-alkanoate (mainly branched C20 alkane-1,2-diol/C14 fatty acid and branched C20 alkane-1,2-diol/C16 fatty acid) bonded by glycosidic linkage to a C6 sugar"

  • Does not produce long-chain polyunsaturated alkenes that are characteristic of Chloroflexus

Membrane Organization:
The carotenoid assembly in Roseiflexus castenholzii regulates quinone diffusion and the architecture of the RC-LH complex, with newly identified exterior carotenoids functioning with bacteriochlorophyll B800 to block the proposed quinone channel between LHαβ subunits in the native RC-LH complex .

These distinctive characteristics create a unique membrane environment that would likely influence the function of membrane proteins like mscL. The thermophilic nature of Roseiflexus (optimal growth at 50°C) would also contribute to differences in membrane fluidity and protein-lipid interactions compared to mesophilic bacteria.

What is known about the genomic context of mscL in Roseiflexus sp.?

The mscL gene in Roseiflexus sp. (strain RS-1) is identified as RoseRS_2342 according to the ordered locus names . While detailed information about the genomic context is limited in the provided search results, we can gather some relevant information:

The genome of Roseiflexus sp. RS-1 has been sequenced and is available through the JGI Genome Portal (http://genome.jgi.doe.gov/finished_microbes/ros_r/ros_r.home.html)[5] . This provides a valuable resource for examining the genomic context of mscL and related genes.

Regarding general genomic features of Roseiflexus sp.:

  • The genome contains the suite of genes required for photoautotrophic metabolism, although photoautotrophic growth has not been achieved in laboratory cultures

  • Both Roseiflexus castenholzii and Roseiflexus sp. RS-1 possess genes for the 3-hydroxypropionate pathway

  • Comparison with metagenomic sequences from microbial mats shows high nucleotide identity (>80%) between isolate genes and the homologous FAP genes in the mat

For researchers interested in exploring the genomic context of mscL in Roseiflexus sp., the following approaches would be valuable:

  • Examining the flanking regions of the RoseRS_2342 locus for potential regulatory elements

  • Comparing the genomic organization around mscL in Roseiflexus with that of other bacterial species

  • Investigating potential operonic structures that might include mscL

  • Analyzing the promoter region for regulatory motifs related to osmotic stress or other environmental factors

This genomic context analysis could provide insights into the regulation of mscL expression and its potential coordination with other stress response or membrane-related functions in Roseiflexus sp.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.