Recombinant Roseiflexus sp. NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Definition and General Characteristics

Roseiflexus sp. NADH-quinone oxidoreductase subunit A (nuoA) represents a membrane-associated subunit of the larger NADH-quinone oxidoreductase complex (Complex I), which serves as a fundamental component of the electron transport chain in cellular respiration. This protein exists as a full-length 118 amino acid sequence with distinct hydrophobic properties, consistent with its membrane-embedded function . When produced recombinantly, nuoA is typically fused to an N-terminal His-tag and expressed in Escherichia coli systems, resulting in a highly purified protein product (>90% purity by SDS-PAGE analysis) .

Taxonomic Context of Roseiflexus sp.

Roseiflexus species are filamentous anoxygenic phototrophic bacteria belonging to the phylum Chloroflexi. These organisms have been primarily isolated from alkaline siliceous hot springs, particularly within Yellowstone National Park . Roseiflexus species display remarkable metabolic versatility, capable of both photoheterotrophic growth and chemoheterotrophic metabolism under dark aerobic conditions . Unlike other related phototrophs such as Chloroflexus, Roseiflexus species contain bacteriochlorophyll a but notably lack bacteriochlorophyll c and chlorosomes . The two primary species studied in scientific literature are Roseiflexus sp. RS-1 and Roseiflexus castenholzii, with the former being more extensively characterized through genomic sequencing projects .

Genetic Information and Nomenclature

Table 1: Gene and Protein Identification for nuoA in Roseiflexus species

SpeciesGene NameSynonymsUniProt IDProtein Length
Roseiflexus sp.nuoARoseRS_2989, NADH-quinone oxidoreductase subunit A, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1A5UXK0118 aa
Roseiflexus castenholziinuoARcas_2088, NADH-quinone oxidoreductase subunit A, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1A7NL04118 aa

The gene encoding nuoA in Roseiflexus sp. is referenced as RoseRS_2989 in genomic databases and is annotated as part of the NADH-quinone oxidoreductase complex . This gene has been identified through both genomic sequencing of isolated strains and metagenomic analyses of hot spring microbial communities . The consistent presence of nuoA across Roseiflexus species underscores its fundamental role in the respiratory apparatus of these organisms.

Expression Systems and Methodology

Recombinant production of Roseiflexus sp. nuoA relies on heterologous expression in E. coli systems . The full-length protein (spanning amino acids 1-118) is typically expressed with an N-terminal histidine tag to facilitate downstream purification processes . While the search results do not detail the specific expression vectors employed, standard bacterial expression systems utilizing inducible promoters would be appropriate for membrane protein production.

Purification and Quality Control

Table 2: Purification and Storage Specifications for Recombinant nuoA

ParameterSpecificationNotes
Physical FormLyophilized powderRequires reconstitution before use
Purity>90%As determined by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Stabilizes protein during lyophilization
Storage Temperature-20°C to -80°CAliquoting recommended to avoid freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Addition of 5-50% glycerol recommended for long-term storage
StabilityWorking aliquots stable at 4°C for up to one weekRepeated freezing and thawing not recommended

The purification strategy for His-tagged nuoA likely employs immobilized metal affinity chromatography (IMAC) to selectively capture the target protein . Quality control measures include SDS-PAGE analysis to confirm purity exceeding 90% . The final product is supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability during storage .

Role in NADH-Quinone Oxidoreductase Complex

The nuoA protein functions as an integral membrane subunit of Complex I (NADH-quinone oxidoreductase), which catalyzes the transfer of electrons from NADH to quinones coupled with proton translocation across the membrane . This process contributes to establishing the proton gradient that drives ATP synthesis through oxidative phosphorylation. While the specific structural arrangement of nuoA within the Roseiflexus Complex I has not been explicitly detailed in the available literature, comparative analyses with better-characterized bacterial systems suggest it likely occupies a position within the membrane domain of the complex.

Integration with Photosynthetic Apparatus

Roseiflexus species possess a distinctive cyclic electron transport chain that enables anoxygenic photosynthesis . This system includes a reaction center (RC)-light-harvesting (LH) complex, an alternative complex III (ACIII), and electron carriers such as auracyanin and cytochrome c 551 . Recent research has identified a previously unknown monoheme cytochrome c (cyt c 551) as a novel periplasmic electron acceptor that participates in completing the cyclic electron transport chain in Roseiflexus castenholzii .

The interaction between the respiratory complex containing nuoA and the photosynthetic apparatus likely varies depending on growth conditions. During photoheterotrophic growth, the photosynthetic electron transport chain would predominate, while under dark aerobic conditions, the respiratory chain involving Complex I would become more significant .

Evolutionary Context

Genomic analyses of Roseiflexus species have revealed interesting adaptations that facilitate life under varying environmental conditions. The presence of duplicate genes and gene clusters in related organisms like Chloroflexus aurantiacus suggests evolutionary mechanisms for functional versatility . While not explicitly stated in the search results, the nuoA gene's conservation across Roseiflexus species indicates selective pressure maintaining this component of the respiratory machinery.

Current Research Applications

Recombinant nuoA protein serves multiple research purposes, including:

  1. Structural studies: Purified nuoA can contribute to crystallographic or cryo-electron microscopic investigations of Complex I architecture.

  2. Biochemical assays: The protein enables in vitro reconstruction experiments to study electron transfer mechanisms.

  3. Antibody production: Recombinant nuoA can serve as an antigen for generating specific antibodies for immunodetection studies.

  4. Comparative analyses: The protein facilitates evolutionary studies comparing respiratory complexes across the Chloroflexi phylum.

Biotechnological Potential

The thermostable nature of proteins from thermophilic organisms like Roseiflexus species presents potential biotechnological applications:

  1. Bioenergy systems: Understanding electron transport mechanisms in these photosynthetic bacteria could inform the development of artificial photosynthesis technologies.

  2. Extremozyme applications: Thermostable proteins may offer advantages in industrial processes requiring robust enzymatic activities under harsh conditions.

  3. Bioremediation strategies: The metabolic versatility of Roseiflexus species suggests potential applications in environmental remediation.

Future Research Directions

Future investigations involving Roseiflexus sp. nuoA could focus on:

  1. High-resolution structural determination of the complete Complex I from Roseiflexus species.

  2. Functional studies examining the role of nuoA in proton translocation and energy conservation.

  3. Comparative analyses of Complex I composition and function across the Chloroflexi phylum.

  4. Investigation of regulatory mechanisms controlling nuoA expression under different growth conditions.

  5. Exploration of the interaction between respiratory and photosynthetic electron transport chains in these metabolically versatile organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; RoseRS_2989; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Roseiflexus sp. (strain RS-1)
Target Names
nuoA
Target Protein Sequence
MLANYAFIGVFFIGAIIFPIIPLAAAYFLGPKRPTPIKLDTYECGLEAIGDIRVQFKIQY YLYALAFVIFDIEVVFLYPWAVAYGQLGLFAFIAMAIFLIILIGGLVYEWKKGALEWV
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus harnessing redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what role does it play in bacterial respiration?

NuoA is a small membrane-spanning subunit of the respiratory chain NADH:quinone oxidoreductase (Complex I). In Roseiflexus species and other bacteria, this protein contributes to the electron transport chain of cellular respiration. Complex I catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane, establishing the proton motive force used for ATP synthesis. Unlike other core protein subunits of Complex I, nuoA has no known homologues in other enzyme systems, making it unique to this respiratory complex . The protein is essential for proper assembly and function of the entire Complex I structure, which serves as the initial electron entry point in the respiratory chain.

How does Roseiflexus sp. nuoA compare to homologous proteins in other bacterial species?

While nuoA has no homologues outside Complex I, similar proteins exist across different bacterial species. Significant research has been conducted on nuoA homologues in Escherichia coli (also called nuoA) and Paracoccus denitrificans (where the homologous protein is called NQO7). Despite their similarities, important structural differences exist between these proteins. Research has demonstrated that the transmembrane orientation of nuoA differs between organisms. In E. coli, the C-terminal end of the polypeptide localizes to the bacterial cytoplasm, which contradicts previous reports for the homologous NQO7 subunit from P. denitrificans .

The varying distribution of charged amino acid residues in nuoA across different organisms contributes to these structural differences and creates challenges for computational prediction of membrane topology . These variations likely reflect evolutionary adaptations to different ecological niches and metabolic strategies employed by these bacteria. Roseiflexus sp., as a photosynthetic bacterium belonging to the Chloroflexi phylum, represents an interesting evolutionary position for comparative studies of respiratory complex components.

What is known about the transmembrane orientation of nuoA and how does this impact functional studies?

The transmembrane orientation of nuoA presents an interesting research challenge due to conflicting findings across species. Research on E. coli nuoA has demonstrated that the C-terminal end of the polypeptide localizes to the bacterial cytoplasm, as determined through analyses of fusion proteins with cytochrome c and alkaline phosphatase . This finding notably contradicts previous reports for the homologous NQO7 subunit from Paracoccus denitrificans, highlighting the complexity of membrane protein topology prediction and the importance of experimental verification .

For Roseiflexus sp. nuoA specifically, the transmembrane orientation must be experimentally determined using similar approaches. The small size of the polypeptide (118 amino acids) and the varying distribution of charged amino acid residues make computational prediction unreliable. Understanding the correct orientation is crucial for elucidating the protein's role in proton translocation and electron transfer within Complex I. This knowledge would significantly impact experimental design for functional studies, particularly those investigating proton pumping mechanisms or protein-protein interactions within the complex.

How does the evolutionary position of Roseiflexus sp. influence the study of its respiratory components like nuoA?

Roseiflexus sp. belongs to the phylum Chloroflexi, a deep-branching lineage of Bacteria that includes thermophilic organisms capable of chlorophototrophy (light-energy conversion based on chlorophyll) . This evolutionary position makes Roseiflexus sp. particularly interesting for studying the co-evolution of respiratory and photosynthetic systems.

Phylogenetic analysis based on the deduced amino acid sequences of photosynthetic reaction center subunits suggests that Roseiflexus species diverged from their relatives like Chloroflexus aurantiacus at distinct points in evolutionary history . This divergence provides a unique opportunity to study how respiratory components like nuoA may have co-evolved with the photosynthetic apparatus. Unlike some relatives, Roseiflexus lacks chlorosomes (specialized light-harvesting structures) , suggesting differences in energy metabolism strategy that may be reflected in respiratory chain components.

The filamentous anoxygenic phototrophs (FAPs) like Roseiflexus are metabolically versatile organisms that inhabit a wide range of aquatic and mat habitats, particularly thermophilic environments like the alkaline siliceous hot springs in Yellowstone National Park . Studying nuoA in the context of this ecological and evolutionary background can provide insights into adaptation mechanisms of respiratory complexes to extreme environments and diverse energy metabolism strategies.

What methodological approaches are most effective for studying the integration of nuoA into Complex I structure?

Investigating how nuoA integrates into the larger Complex I structure requires sophisticated methodological approaches that preserve native protein-protein interactions while providing high-resolution structural information. Several complementary techniques offer particular advantages:

  • Cryo-electron microscopy (cryo-EM) represents one of the most powerful approaches for studying membrane protein complexes. This technique can potentially resolve the structure of intact Complex I, showing nuoA's position and interactions with neighboring subunits. The relatively small size of nuoA (118 amino acids) presents challenges but also opportunities for studying how small subunits integrate into larger respiratory complexes.

  • Crosslinking mass spectrometry can capture interactions between nuoA and other Complex I components. Chemical crosslinkers applied to intact membranes or purified complexes can freeze transient interactions, which can then be identified through mass spectrometry analysis of crosslinked peptides.

  • Genetic approaches, including site-directed mutagenesis followed by functional assays, can identify critical residues involved in nuoA integration and function. Mutations that disrupt complex assembly versus those that primarily affect function can help distinguish structural from functional roles.

  • Reconstitution studies using purified components can systematically investigate the assembly pathway and stability requirements. For example, researchers might ask whether nuoA can be incorporated into partially assembled Complex I subcomplexes or whether it is required early in the assembly process.

Each of these approaches provides complementary information about nuoA's structural integration, with the combination offering the most comprehensive understanding of this protein's role in Complex I.

What expression systems are optimal for recombinant production of Roseiflexus sp. nuoA?

  • E. coli strain selection: For membrane proteins like nuoA, specialized E. coli strains designed for membrane protein expression offer advantages. While standard BL21(DE3) strains can work, C41(DE3), C43(DE3), or Lemo21(DE3) strains often provide improved results for challenging membrane proteins by allowing slower expression that better matches the membrane insertion capacity.

  • Expression vector considerations: Vectors with tunable promoters allow optimization of expression levels. The commercially available Roseiflexus sp. nuoA is produced with an N-terminal His tag, facilitating purification . For nuoA, the position of this tag may affect membrane insertion and should be considered carefully.

  • Induction conditions: Optimization of temperature, inducer concentration, and induction duration is crucial for membrane proteins. Lower temperatures (16-25°C) often improve folding and membrane insertion compared to standard 37°C induction.

  • Alternative expression systems: While E. coli is confirmed to work for nuoA expression , other systems may offer advantages for specific applications:

    • Yeast systems (Pichia pastoris) for eukaryotic-like membrane environments

    • Cell-free expression systems with supplied lipids/detergents for direct incorporation into membrane mimetics

    • Bacterial cell-derived membrane vesicles for near-native membrane environment

A systematic approach testing multiple conditions is typically necessary to establish an optimal protocol for each specific research application involving nuoA.

What purification strategies maximize yield and activity of recombinant nuoA protein?

Purification of membrane proteins like nuoA requires specialized approaches to maintain structural integrity and potential function. Based on the product information and general membrane protein handling principles, the following strategies are recommended:

  • Solubilization optimization: Screen multiple detergents at various concentrations to identify conditions that efficiently extract nuoA from membranes while maintaining its structure. Common starting points include:

    • Mild detergents: DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol)

    • Zwitterionic detergents: LDAO (Lauryldimethylamine oxide)

    • Non-ionic detergents: Triton X-100 or OG (Octyl glucoside)

  • Affinity purification: The N-terminal His tag on the recombinant Roseiflexus sp. nuoA enables metal affinity chromatography (IMAC). Consider:

    • Using low imidazole concentrations in wash buffers to reduce non-specific binding

    • Including the optimized detergent at concentrations above CMC throughout purification

    • Eluting with imidazole gradient to identify the minimum concentration needed

  • Secondary purification: For higher purity, consider size exclusion chromatography (SEC) or ion exchange chromatography as secondary steps after IMAC.

  • Buffer optimization: The commercial recombinant nuoA is provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , which provides a starting point for buffer optimization. Consider screening:

    • pH range (typically 6.5-8.5)

    • Salt concentration (150-500 mM NaCl)

    • Stabilizing additives (glycerol, specific lipids)

  • Storage considerations: The product information recommends storing the lyophilized protein at -20°C/-80°C and making aliquots to avoid repeated freeze-thaw cycles . For reconstituted protein, addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C, while working aliquots can be stored at 4°C for up to one week .

Optimizing these parameters can significantly improve both yield and stability of purified nuoA protein for subsequent structural and functional studies.

What techniques can be used to study the membrane topology of nuoA?

Understanding the membrane topology of nuoA is crucial for elucidating its function. Several complementary techniques can provide this information:

  • Fusion protein approaches: As demonstrated with E. coli nuoA, fusion of reporter proteins to different segments of nuoA can reveal their cellular localization . Effective reporters include:

    • Cytochrome c fusions: These fold properly only in the periplasm

    • Alkaline phosphatase fusions: These are enzymatically active only in the periplasm

    • GFP variant fusions: Certain variants fold properly only in specific cellular compartments

  • Substituted cysteine accessibility method (SCAM): This technique involves:

    • Introducing cysteine residues at various positions throughout nuoA

    • Testing their accessibility to membrane-impermeable thiol-reactive reagents

    • Differential labeling with membrane-permeable and impermeable reagents to distinguish cytoplasmic from periplasmic residues

  • Protease protection assays: By treating membrane preparations with proteases, researchers can determine which protein segments are accessible (and thus on the surface) versus those protected by the membrane. When combined with domain-specific antibodies, this approach can map the topology in detail.

  • Structural biology approaches: Cryo-electron microscopy of the entire Complex I could reveal the position and orientation of nuoA within the larger complex. This would provide the most comprehensive view of nuoA topology in its native context.

The contradicting findings regarding the orientation of nuoA homologues in different organisms highlight the importance of experimental verification rather than relying solely on computational predictions . For Roseiflexus sp. nuoA specifically, multiple complementary approaches should be employed to establish its membrane topology with confidence.

How can researchers ensure FAIR data practices when working with nuoA experimental data?

Implementing FAIR (Findable, Accessible, Interoperable, Reusable) data principles for nuoA research requires thoughtful planning from the beginning of a research project. Based on recommendations for life science data management , researchers should consider the following practices:

  • Planning data management upstream: Rather than attempting to make data FAIR after experiments are completed, researchers should incorporate FAIR principles from the start of the research process . For nuoA studies, this means planning standardized data collection formats before beginning expression, purification, or functional studies.

  • Experimental design documentation: Document the design of experiments thoroughly, including all factors and their levels . For nuoA studies, this might include a structured description of expression conditions, purification protocols, and functional assay parameters.

  • Data structure and formatting: Organize experimental data in structured tables with clear headings and consistent units. For example, a membrane topology study might use the following structure:

Construct IDFusion PositionReporterActivity ValueActivity UnitsMembrane FractionInterpretationProtocol Reference
nuoA-C-term-APC-terminusAlkaline Phosphatase358Miller UnitsInner membraneCytoplasmicDOI: 10.xxxx/xxxxx
  • Semantic enrichment: Use controlled vocabularies and ontologies relevant to protein research. Link experimental entities to persistent identifiers where possible, such as using the UniProt ID (A5UXK0) for Roseiflexus sp. nuoA .

  • Data deposition and sharing: Deposit raw data in appropriate repositories (e.g., proteomics data in PRIDE, structural data in PDB) and ensure all shared data has appropriate metadata and contextual information.

These FAIR data practices not only improve reproducibility and transparency but also contribute to the broader scientific community's ability to build upon findings related to nuoA structure and function .

What controls are essential when studying protein-protein interactions involving nuoA?

  • Expression and purification controls:

    • Negative control: Empty vector-transformed cells processed identically to nuoA-expressing cells to identify non-specific interactions

    • Tag-only control: Expression of the tag without nuoA to identify tag-mediated interactions

    • Denatured sample control: Heat-denatured nuoA samples to distinguish specific from non-specific interactions

  • Crosslinking specificity controls:

    • Concentration gradient: Multiple crosslinker concentrations to establish optimal crosslinking conditions

    • Temporal controls: Time-course experiments to capture the progression of crosslinking

    • Negative controls: Omission of crosslinker to identify non-crosslinking-dependent associations

  • Co-immunoprecipitation controls:

    • Pre-immune serum control: When using antibodies, include pre-immune serum controls to assess non-specific binding

    • Competitive inhibition: Include excess antigen when possible to demonstrate specificity

    • Reciprocal co-IP: Perform the experiment in both directions (pull down protein A to find B, then pull down B to find A)

  • Membrane integrity controls:

    • For studies involving intact membranes, verify membrane integrity through appropriate markers

    • For reconstituted systems, verify incorporation and orientation of proteins

  • Biological relevance controls:

    • Mutational analysis: Test interaction with mutated versions of nuoA to identify critical interaction interfaces

    • Correlation with function: Establish whether interaction strength correlates with functional outcomes (e.g., Complex I activity)

How should researchers interpret differences in nuoA structure or function between Roseiflexus sp. and other bacterial species?

Interpreting differences in nuoA across bacterial species requires careful consideration of several factors:

  • Evolutionary context: Roseiflexus sp. belongs to the Chloroflexi phylum, a deep-branching lineage of bacteria . Differences between its nuoA and those of proteobacteria like E. coli or P. denitrificans may reflect deep evolutionary divergence rather than specific functional adaptations. Phylogenetic analyses of reaction center subunits have already demonstrated divergence between Roseiflexus and related genera like Chloroflexus .

  • Ecological adaptations: Roseiflexus species typically inhabit thermophilic environments like hot springs . Differences in protein structure may represent adaptations to these extreme conditions. When comparing to mesophilic bacteria, researchers should consider whether structural differences might contribute to thermostability.

  • Metabolic context: As a photosynthetic bacterium, Roseiflexus has distinct energy metabolism compared to non-phototrophs . Differences in respiratory chain components like nuoA might reflect integration with photosynthetic electron transport. Researchers should consider whether structural variations correlate with differences in metabolic capabilities.

  • Membrane environment: Different bacteria have distinct membrane compositions. Variations in nuoA structure might be adaptations to specific lipid environments. Experimental approaches should consider these differences when performing heterologous expression or functional reconstitution.

  • Structural conservation: Despite differences, functionally critical regions should show conservation across species. Identifying conserved versus variable regions can help distinguish core functional elements from adaptable structural features.

When encountering contradictory results between species, as seen with the transmembrane orientation of nuoA/NQO7 in E. coli versus P. denitrificans , researchers should consider whether these represent genuine biological differences rather than methodological artifacts. Multiple complementary experimental approaches applied across species can help resolve such contradictions.

What strategies can resolve low expression issues for recombinant nuoA?

Membrane proteins like nuoA frequently present expression challenges. The following strategies can help overcome low expression issues:

  • Expression system optimization:

    • Try specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

    • Reduce expression temperature (16-25°C instead of 37°C)

    • Use lower inducer concentrations (e.g., 0.1-0.5 mM IPTG instead of 1 mM)

    • Extend induction time (overnight at lower temperatures)

    • Consider auto-induction media for gradual protein production

  • Construct design improvements:

    • Test both N-terminal and C-terminal His tags (the commercial version uses N-terminal His tag)

    • Try fusion partners known to enhance membrane protein expression (MBP, SUMO)

    • Optimize codon usage for the expression host

    • Include appropriate signal sequences if necessary for membrane targeting

  • Media and growth condition adjustments:

    • Add membrane components (e.g., additional phospholipids) to growth media

    • Include chemical chaperones in growth media (glycerol, betaine)

    • Try different media formulations (TB, 2xYT, minimal media)

    • Maintain tight aeration control during growth

  • Co-expression strategies:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Consider co-expressing with other Complex I subunits that interact with nuoA

    • Add rare tRNA plasmids to overcome codon bias issues

  • Detection optimization:

    • Ensure sensitive detection methods are used (Western blotting with anti-His antibodies)

    • Check both soluble and membrane fractions to determine protein localization

    • Consider that apparent "low expression" might sometimes be poor extraction rather than poor expression

The successful production of recombinant Roseiflexus sp. nuoA with N-terminal His tag in E. coli demonstrates that expression is feasible, but optimization of conditions may be necessary for specific experimental requirements.

How can researchers overcome challenges in membrane topology determination for nuoA?

Membrane topology determination for small proteins like nuoA presents specific challenges. The following approaches can help overcome these difficulties:

  • Resolving conflicting computational predictions:

    • Run multiple prediction algorithms (TMHMM, HMMTOP, Phobius)

    • Compare predictions with homologous proteins of known topology

    • Use consensus approaches that integrate multiple prediction methods

    • Remember that predictions are starting points, not definitive answers

  • Dealing with inconclusive reporter fusion results:

    • Create a comprehensive series of fusion points throughout the protein

    • Use multiple different reporter systems in parallel

    • Normalize reporter activity appropriately for each fusion construct

    • Check for proper expression and membrane integration of each fusion protein

  • Addressing challenges with cysteine scanning approaches:

    • Start with a cysteine-free version of nuoA if native cysteines are present

    • Verify that cysteine mutations do not disrupt protein folding

    • Use both membrane-permeable and impermeable reagents to distinguish sides

    • Include controls with known cytoplasmic and periplasmic cysteines

  • Overcoming protease accessibility limitations:

    • Use proteases with different specificities

    • Verify membrane integrity during protease treatment

    • Use mass spectrometry to identify protected fragments precisely

    • Include controls with known topology to validate the approach

  • Resolving contradictions between methods:

    • Prioritize methods based on reliability in your specific system

    • Consider whether contradictions might reflect genuine flexibility in topology

    • Integrate structural information when available (e.g., from cryo-EM)

    • Remember that the E. coli nuoA orientation contradicted previous findings for the P. denitrificans homologue , suggesting that careful verification is essential

  • Addressing challenges specific to small membrane proteins:

    • Consider that tight packing might limit accessibility to some reagents

    • Be aware that fusion reporters might influence topology of very small proteins

    • Use minimally disruptive approaches when possible

These strategies can help researchers overcome the particular challenges of determining membrane topology for nuoA, where the small size of the protein and potential interactions with other Complex I components add complexity to the analysis.

What approaches can resolve stability issues with purified nuoA protein?

Maintaining stability of membrane proteins like nuoA after purification is often challenging. The following approaches can help resolve stability issues:

  • Detergent optimization:

    • Screen multiple detergent classes (maltoside, glucoside, fos-choline series)

    • Test detergent concentration ranges for each promising candidate

    • Consider mixed detergent systems which sometimes improve stability

    • Try newer amphipathic polymers (amphipols, nanodiscs) which can provide more stable environments

  • Buffer optimization:

    • The commercial product uses a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , which provides a starting point

    • Screen pH ranges (typically 6.5-8.5) to identify optimal stability conditions

    • Test different salt concentrations and types (NaCl, KCl)

    • Add stabilizers like glycerol (5-20%) as recommended for the recombinant product

  • Lipid supplementation:

    • Add specific lipids during or after purification

    • Test both synthetic lipids and native bacterial lipid extracts

    • Consider cardiolipin, which often stabilizes respiratory complex proteins

    • For functional studies, reconstitute into liposomes with defined lipid composition

  • Storage condition optimization:

    • Store at -20°C or -80°C with glycerol (5-50%) as recommended

    • Make small aliquots to avoid repeated freeze-thaw cycles

    • For short-term storage, 4°C for up to one week is acceptable

    • Consider flash-freezing in liquid nitrogen for long-term storage

  • Stabilizing co-factors or ligands:

    • Identify potential stabilizing ligands through thermal shift assays

    • For Complex I proteins, consider including quinone analogues

    • Test whether nucleotides provide stability enhancement

    • Consider metal ions that might stabilize specific conformations

  • Protein engineering approaches:

    • Identify and mutate surface-exposed hydrophobic residues

    • Consider disulfide engineering to stabilize flexible regions

    • Test truncation constructs to remove disordered regions

    • Explore thermostabilizing mutations identified in related proteins

These approaches should be applied systematically, often in combination, to identify conditions that maintain nuoA in its native conformation through purification and subsequent experimental procedures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.