Recombinant Roseiflexus sp. Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

Introduction

Ribonuclease Y (RNase Y), initially identified as YmdA, is an endoribonuclease crucial for mRNA degradation in bacteria . It plays a vital role in regulating gene expression and facilitating rapid cellular responses to changing environmental conditions . RNase Y orthologues are found in approximately 40% of sequenced eubacterial species, highlighting its widespread importance in bacterial physiology .

Discovery and Function

RNase Y was first recognized in Bacillus subtilis and characterized as an essential enzyme involved in the initiation of RNA degradation . Depletion of RNase Y significantly increases the half-life of bulk mRNA, indicating its importance in mRNA turnover . This endoribonuclease is not only crucial for riboswitch RNA turnover but also serves as a key player in initiating mRNA decay in B. subtilis .

Mechanism of Action

RNase Y functions as an endoribonuclease, cleaving RNA internally to initiate its degradation . The cleavage activity of RNase Y requires the presence of magnesium ions (Mg2+) . The enzyme targets SAM-dependent riboswitches, initiating the decay of S-box gene family members .

Role in Riboswitch Turnover

RNase Y initiates the decay of SAM-dependent riboswitches present in B. subtilis . Northern blot analysis of the 11 S-box genes in B. subtilis revealed that RNase Y initiates the decay of most of these genes, except for cysH, which is primarily regulated at the level of transcription initiation .

Impact on mRNA Stability

Depletion of RNase Y leads to increased mRNA stability . Studies using rifampicin treatment followed by RNA-seq (RIF-seq) have shown that transcripts encoding major virulence regulators exhibit increased abundance and RNA stability in RNase Y deletion strains (Δrny) . This suggests a direct role of RNase Y in regulating these targets .

RNase Y in Other Bacteria

While the primary research on RNase Y has been conducted in Bacillus subtilis, orthologues of this enzyme are found in a wide range of eubacterial species . Studies in Escherichia coli and Salmonella enterica have also explored the role of RNase Y in RNA degradation and stability .

Methodologies for Characterization

Various RNA sequencing strategies are employed to investigate the activity of bacterial ribonucleases, including RNase Y . Transcriptome analyses, such as tiling arrays and RNA-seq, have been applied to study the effects of RNase Y depletion on RNA degradation and processing . These methods provide insights into the genome-wide activity of RNase Y and its impact on the transcriptome .

Essentiality and Complementation Assays

The essentiality of RNase Y in B. subtilis has been confirmed through complementation assays . A B. subtilis strain with rny expression controlled by a xylose repressor is unable to grow without xylose . Transformation of this strain with a plasmid encoding the full-length rny gene results in xylose-independent growth, demonstrating that the plasmid-borne RNase Y effectively complements the chromosomal copy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; RoseRS_0330; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Roseiflexus sp. (strain RS-1)
Target Names
rny
Target Protein Sequence
MFEPVATARHWAVACCTFTIEQEDVVQWLIWALPALVIGLAIGAGIGILIYKKSVQSQIR QIEAEARLQLEATRSEQKDLILRATDEALRLRAEAEAQIREARAALAKQEERLQRKEENL DRKIEGLERRERQLQQRERQMEQLHQEAEQLRQQQRAELERISALSQEEARAIILKRVED ETRDEAARRIREIEKNVREEADKLARKVISMAIQRCASEYVAEVTVSTVALPSEELKGRI IGREGRNIRAFEQLTGVDIIVDDTPEAVTLSCHDPVRREVARLALIKLLKDGRIHPTRIE EVVSKTQQEVEQIMREEGERVAYEANVQGLHPDLIKLLGRLKYRTSYGQNVLQHSLECAL LAAHIAAEIGANINVAKTAALLHDIGKAVDHEVQGPHALIGAEIARRLGKSPAIVHAIAA HHNDEEPQTVEAWLVQAVDAISGGRPGARRETLDLYIKRLEALETVATSFTGVQRAFAVQ AGREVRVMVQPDAIDDLGSIHLARDVAKKIEESLQYPGQIKVTVIRETRAVDYAR
Uniprot No.

Target Background

Function
An endoribonuclease initiating mRNA decay.
Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y and what is its significance in bacterial systems?

Ribonuclease Y (RNase Y) is an essential endoribonuclease involved in RNA metabolism across various bacterial species. It plays a critical role in the initiation of mRNA decay, particularly in Gram-positive organisms where the initiation of mRNA decay differs significantly from that in Escherichia coli. RNase Y has been identified as a key enzyme that preferentially cleaves 5′ monophosphorylated riboswitches upstream of the binding domain, thus initiating their turnover . Notably, about 40% of sequenced eubacterial species possess an RNase Y orthologue, highlighting its evolutionary conservation and biological importance .

What is the optimal reconstitution protocol for Recombinant Roseiflexus sp. RNase Y?

For optimal reconstitution of lyophilized Recombinant Roseiflexus sp. RNase Y protein, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is advisable to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot the solution for storage at -20°C/-80°C . This approach minimizes protein degradation from repeated freeze-thaw cycles, which can significantly compromise enzyme activity and stability.

How can researchers effectively express and purify Recombinant Roseiflexus sp. RNase Y?

Expression of Recombinant Roseiflexus sp. RNase Y can be effectively achieved using E. coli expression systems . For optimal expression:

  • Clone the rny gene (UniProt ID: A5UQ59) into an appropriate expression vector containing an N-terminal His tag.

  • Transform the construct into a compatible E. coli strain optimized for protein expression.

  • Induce protein expression using standard protocols (IPTG induction for most systems).

  • Harvest cells and lyse using buffer systems that maintain protein stability.

  • Purify using immobilized metal affinity chromatography (IMAC) leveraging the His tag.

  • Consider additional purification steps such as size exclusion chromatography to achieve >90% purity.

  • Store the purified protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for optimal stability .

What are the recommended assays for measuring RNase Y enzymatic activity?

To assess the enzymatic activity of Recombinant Roseiflexus sp. RNase Y, researchers can employ several complementary approaches based on established methodologies used for studying RNase Y in other bacterial species:

  • In vitro RNA cleavage assays: Synthesize 5′ monophosphorylated RNA substrates and incubate with the purified RNase Y. Analyze cleavage products using polyacrylamide gel electrophoresis followed by northern blotting or radiolabeling .

  • Primer extension analysis: This technique can identify specific cleavage sites within RNA substrates by using primers that bind downstream of potential cleavage sites, allowing for precise mapping of the endoribonuclease activity .

  • 5′/3′ RACE experiments: This approach can be used to identify the exact cleavage sites in target RNAs, as demonstrated in studies with other RNase Y orthologs .

  • S1 mapping analysis: This technique can be employed to analyze downstream cleavage products and verify cleavage sites identified through other methods .

What is the subcellular localization of RNase Y and how does it impact function?

RNase Y has been identified as a membrane-associated protein in various bacterial species, including Helicobacter pylori . This membrane association likely influences its access to substrate RNAs and its interaction with other components of the RNA degradation machinery. The amino acid sequence of Roseiflexus sp. RNase Y contains hydrophobic regions suggestive of membrane-binding domains, particularly in the N-terminal portion . This subcellular localization is functionally significant as it may create microenvironments where RNA processing occurs in proximity to the membrane, potentially coordinating RNA metabolism with other cellular processes.

How does Roseiflexus sp. RNase Y compare functionally with RNase Y orthologs from other bacterial species?

Comparison of RNase Y across different bacterial species reveals both conserved functions and species-specific adaptations:

The broader evolutionary context suggests RNase Y represents an important component of RNA metabolism across diverse bacterial lineages, with about 40% of sequenced eubacterial species containing an RNase Y ortholog .

What is the current understanding of RNase Y's role in bacterial stress responses and adaptation?

Research on RNase Y orthologs suggests important roles in bacterial stress responses and adaptation:

  • Iron regulation: In H. pylori, RNase Y expression is regulated by Fur in response to iron availability, suggesting a role in adaptation to iron-limited environments .

  • Growth phase regulation: RNase Y expression varies during bacterial growth phases, indicating potential roles in adapting RNA metabolism to changing nutrient availability .

  • Virulence regulation: Through its processing of regulatory RNAs like CncR1 in H. pylori, RNase Y can influence virulence-associated processes such as motility and adhesion to host cells .

What are common challenges in working with recombinant RNase Y and how can they be addressed?

Researchers working with Recombinant Roseiflexus sp. RNase Y may encounter several technical challenges:

  • Protein solubility issues: Due to membrane-association domains, RNase Y may exhibit solubility problems. Consider using detergents or optimizing buffer conditions to improve solubility while maintaining activity.

  • Stability concerns: To prevent activity loss, store the protein in appropriate buffer (Tris/PBS-based with 6% Trehalose, pH 8.0) and avoid repeated freeze-thaw cycles by preparing single-use aliquots with 50% glycerol for long-term storage at -20°C/-80°C .

  • Activity verification: Confirm enzymatic activity before experimental use through cleavage assays with known substrates.

  • Contaminating RNases: Ensure all buffers and labware are RNase-free to avoid experimental artifacts from contaminating nucleases.

  • Substrate preparation: For accurate activity assessment, ensure RNA substrates have the correct 5′ phosphorylation status, as RNase Y preferentially cleaves 5′ monophosphorylated RNAs .

How can researchers design knockout or depletion studies to investigate RNase Y function in various bacterial systems?

For effective functional studies of RNase Y through genetic manipulation:

  • Gene knockout strategies:

    • For non-essential RNase Y (as in H. pylori), direct gene replacement with an antibiotic resistance marker can be used

    • Verify knockout by PCR, sequencing, and Western blot

  • Conditional expression systems:

    • For essential RNase Y functions, use inducible promoters to control expression levels

    • IPTG-inducible systems have been successfully used for RNase Y depletion studies

  • Phenotypic characterization:

    • Monitor growth rates to assess fitness effects (e.g., Δrny strains show ~30% increased generation time in H. pylori)

    • Perform transcriptome analysis to identify affected transcripts

    • Use RNA stability assays to measure changes in RNA decay kinetics

  • Complementation studies:

    • Reintroduce wild-type or mutant RNase Y to confirm phenotype specificity

    • Express orthologs from other species to test functional conservation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.