Recombinant Roseobacter denitrificans ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please inform us of any specific tag requirements for prioritized development.
Synonyms
atpF2; atpG; atpX; RD1_1324; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)
Target Names
atpF2
Target Protein Sequence
MATETNGADVAASSPGMPQLDFSTWGNQIFWLVITLVIIYMVLSKVALPRIAAILSERQG TITNDIATAEDFKAKAKDAEAAYEKALADARAEAQRIVAEAKADIQSDLDVAISKADAEI AAKAAESEKAIAEIRAGAAEAIQQVAKDTAQEIVATFGGKADAKAVDAAVDGQLKG
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. The b' subunit, a component of the F0 channel, forms part of the peripheral stalk, connecting F1 and F0. The b' subunit is a diverged and duplicated form of the b subunit found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Roseobacter denitrificans and why is it significant for studying ATP synthase?

    Roseobacter denitrificans is a purple aerobic anoxygenic phototroph (AAP) that captures light energy to enhance growth only in the presence of oxygen without producing oxygen. It represents an important model organism within the Roseobacter clade, which comprises more than 10% of the microbial community in some euphotic upper ocean waters. This organism is significant for ATP synthase studies because it exhibits remarkable metabolic versatility, including photoheterotrophic growth in the presence of oxygen and light, as well as anaerobic growth in the dark using nitrate or trimethylamine N-oxide as electron acceptors . This versatility makes it an excellent model for understanding how ATP synthase functions across different metabolic modes.

  • What is the ATP synthase subunit b' (atpG) and what is its role in Roseobacter denitrificans?

    ATP synthase subunit b' (atpG) is an essential component of the F-type ATP synthase (F₁F₀-ATPase) in Roseobacter denitrificans. It is part of the membrane-embedded F₀ sector of the ATP synthase complex. The b' subunit, encoded by the atpG gene (also known as atpX in some annotation systems), forms part of the peripheral stalk that connects the F₁ and F₀ sectors. This connection is crucial for the mechanical coupling between proton translocation through the F₀ sector and ATP synthesis in the F₁ sector. The gene is located in the Roseobacter denitrificans genome as the ordered locus name RD1_1324 .

  • How does the ATP synthase in Roseobacter denitrificans compare to that of other bacteria?

    ATP synthase in Roseobacter denitrificans shares structural similarities with other α-proteobacteria but has distinct features related to its unusual metabolism. While the core machinery is conserved, there are notable differences in regulatory mechanisms compared to strictly anaerobic phototrophs like Rhodobacter species. Unlike some related bacteria, Roseobacter denitrificans must maintain ATP synthesis during both aerobic and anaerobic conditions, and during both light and dark periods. The ATP synthase from close relatives in the α-proteobacteria, such as Paracoccus denitrificans, contains unique inhibitory subunits like the ζ subunit , which may have analogs in Roseobacter species. This allows fine-tuning of ATP synthesis under varying environmental conditions.

Experimental Methodologies

  • What are the most effective methods for expressing recombinant Roseobacter denitrificans atpG protein?

    Based on established protocols for similar proteins, the most effective methods include:

    1. Expression System Selection: E. coli BL21(DE3) or similar strains are recommended due to their reduced protease activity and capacity for high-level expression.

    2. Vector Design: pET-based vectors with T7 promoter systems have proven effective. The exact method used for the commercially available recombinant protein employed the pET101-TOPO expression system .

    3. Expression Conditions: Optimal expression typically occurs at 28-30°C (rather than 37°C) after induction with 0.5-1.0 mM IPTG at mid-log phase (OD₆₀₀ of 0.6-0.8).

    4. Protein Extraction: Due to its membrane association properties, extraction buffers containing mild detergents (0.5-1% n-dodecyl β-D-maltoside) yield better results than standard lysis conditions.

    5. Purification Strategy: A combination of immobilized metal affinity chromatography (with His-tags) followed by size exclusion chromatography provides the highest purity.

  • What are the best assays for evaluating the functional activity of recombinant atpG protein?

    To evaluate functional activity of recombinant atpG, researchers should consider:

    1. Reconstitution Assays: The recombinant atpG must be reconstituted with other ATP synthase subunits to form a functional complex. This can be achieved through heterologous reconstitution using purified components or by complementing atpG-deficient membrane preparations.

    2. ATP Synthesis Measurements: ATP formation can be quantified using bioluminescence assays based on the luciferase enzyme, similar to methods used for ATP sulfurylase activity measurements .

    3. ATP Hydrolysis Assays: The reverse reaction (ATP hydrolysis) can be measured using colorimetric detection of released phosphate or coupled enzyme assays.

    4. Proton Pumping Assays: Function can be assessed by measuring proton translocation using pH-sensitive fluorescent dyes in reconstituted proteoliposomes.

    5. Binding Studies: Surface plasmon resonance or isothermal titration calorimetry can assess the interaction of atpG with other ATP synthase subunits.

  • How can I determine if my recombinant atpG is properly folded and functional?

    Multiple complementary approaches should be employed:

    1. Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content, which can be compared to predictions based on homology models.

    2. Thermal Shift Assays: Assess protein stability and can indicate proper folding.

    3. Limited Proteolysis: Properly folded proteins show characteristic digestion patterns different from misfolded variants.

    4. Functional Reconstitution: The ultimate test is the ability to restore ATP synthase activity when combined with other purified subunits or atpG-deficient membranes.

    5. Co-immunoprecipitation: Confirms the ability to interact with natural binding partners from the ATP synthase complex.

Advanced Research Questions

  • What is the structural relationship between atpG and the regulation of ATP synthase in Roseobacter denitrificans?

    The b' subunit (atpG) in Roseobacter denitrificans acts as a critical structural element in the peripheral stalk of ATP synthase, connecting the membrane-embedded F₀ sector with the catalytic F₁ sector. Research on related α-proteobacteria reveals complex regulatory mechanisms:

    1. The peripheral stalk in α-proteobacteria has specialized features for stabilizing the enzyme during transitions between different metabolic modes.

    2. In Paracoccus denitrificans, a related α-proteobacterium, the ATP synthase is regulated by the ζ inhibitory subunit, which blocks ATP hydrolysis while allowing ATP synthesis .

    3. This unidirectional inhibition by ζ functions as a "pawl-ratchet" mechanism that prevents wasteful ATP hydrolysis under energy-limiting conditions .

    4. Sequence analysis suggests that the b' subunit in Roseobacter denitrificans may have specific interfaces with regulatory proteins that modulate ATP synthase activity in response to changes in light availability and oxygen tension.

    5. The atpG subunit likely contributes to the structural stability needed during rapid transitions between photosynthetic and respiratory metabolism.

  • How does the expression of atpG change under different growth conditions in Roseobacter denitrificans?

    The expression pattern of atpG in Roseobacter denitrificans shows sophisticated regulation across different environmental conditions:

    Growth ConditionRelative atpG ExpressionATP Synthase ActivityMetabolic Context
    Aerobic + LightHighHighPhotoheterotrophic growth with enhanced ATP production
    Aerobic + DarkModerateModerateStandard aerobic respiration
    Anaerobic + NitrateModerateModerateDenitrification pathway active
    Oxygen-limitedVariable (stress-dependent)RegulatedTransition between metabolic modes

    Unlike anaerobic phototrophs that strongly repress photosynthesis genes at high oxygen tensions, Roseobacter denitrificans forms a photosynthetic apparatus even at oxygen saturation . This unique characteristic likely requires specialized regulation of ATP synthase components, including atpG. The expression of atpG appears to be coordinated with other photosynthetic and respiratory chain components to maintain optimal energy production under fluctuating environmental conditions.

  • What are the key differences between ATP synthase structure and function in Roseobacter denitrificans compared to other photosynthetic bacteria?

    Roseobacter denitrificans ATP synthase exhibits several distinct features compared to other photosynthetic bacteria:

    1. Oxygen Tolerance: Unlike anaerobic phototrophs like Rhodobacter sphaeroides, the ATP synthase of Roseobacter denitrificans functions efficiently in the presence of oxygen . This requires structural adaptations to prevent oxidative damage.

    2. Regulatory Mechanisms: In aerobic anoxygenic phototrophs (AAPs) like Roseobacter denitrificans, ATP synthase regulation differs from that in anaerobic phototrophs, with specialized control mechanisms for rapid switching between photosynthetic and respiratory metabolism.

    3. Subunit Composition: While the core subunits are conserved, there are differences in regulatory subunits and peripheral components compared to both oxygenic phototrophs (cyanobacteria) and anaerobic anoxygenic phototrophs (like Rhodobacter).

    4. Genetic Organization: The photosynthetic gene cluster (PGC) organization in Roseobacter denitrificans is unique but shares features with both Rhodobacter species and Rubrivivax gelatinosus . This hybrid nature extends to the ATP synthase genes.

    5. Response to Oxidative Stress: Given the higher sensitivity to singlet oxygen (¹O₂) observed in Roseobacter denitrificans , its ATP synthase has likely evolved structural features to maintain function under photooxidative stress conditions.

  • How can I use recombinant atpG to study the adaptation of Roseobacter denitrificans to marine environments?

    Recombinant atpG provides a valuable tool for investigating the unique adaptations of Roseobacter denitrificans to marine environments:

    1. Salt Tolerance Studies: Perform in vitro studies comparing the stability and activity of recombinant atpG under varying salt concentrations that mimic marine conditions.

    2. Interaction Partner Identification: Use recombinant atpG as bait in pull-down assays with marine environmental samples to identify potential interaction partners specific to oceanic conditions.

    3. Comparative Structural Analysis: Compare structural stability and functional properties with atpG from non-marine bacteria to identify marine-specific adaptations.

    4. Site-Directed Mutagenesis: Create mutations in key residues predicted to be involved in salt adaptation and test their effects on function under marine-like conditions.

    5. In vivo Complementation: Express recombinant atpG variants in atpG-deleted strains to determine which features are essential for survival in simulated marine environments.

Methodological Challenges

  • What are the main challenges in expressing and purifying functional recombinant atpG protein?

    Several critical challenges must be addressed when working with recombinant atpG:

    1. Membrane Association: The b' subunit has hydrophobic regions that can cause aggregation during expression and purification. Using specialized detergents (n-dodecyl β-D-maltoside or CHAPSO) at appropriate concentrations is essential.

    2. Structural Stability: Without its natural binding partners from the ATP synthase complex, the b' subunit may adopt non-native conformations. Co-expression with other ATP synthase components or addition of stabilizing agents may be necessary.

    3. Expression Levels: Codon optimization for the expression host can significantly improve yields, as marine bacterial genes often have different codon usage patterns than common expression hosts like E. coli.

    4. Post-translational Modifications: If present in the native protein, these may be absent in recombinant systems, potentially affecting function.

    5. Functional Assessment: Since b' is part of a multi-subunit complex, assessing its functional integrity requires reconstitution with other components or development of specialized assays for its specific role.

  • How can I troubleshoot low expression yields of recombinant Roseobacter denitrificans atpG?

    When facing low expression yields, consider this systematic troubleshooting approach:

    1. Codon Optimization: Analyze the codon usage in the atpG gene and optimize for E. coli or your chosen expression host. Marine bacteria often use codons that are rare in E. coli.

    2. Expression Temperature: Lower the expression temperature to 16-20°C and extend expression time to 24-48 hours. This reduces inclusion body formation for membrane-associated proteins.

    3. Induction Parameters: Test different IPTG concentrations (0.1-1.0 mM) and induction times. For membrane proteins, lower IPTG concentrations (0.1-0.2 mM) often yield better results.

    4. Growth Media Optimization: Add glycylglycine (50-100 mM) to buffer pH changes during expression, or use auto-induction media for gentler protein expression.

    5. Fusion Tags: Test different fusion partners (MBP, SUMO, or thioredoxin) which can enhance solubility of challenging proteins.

    6. Host Strain Selection: Compare expression in different E. coli strains (BL21, C41/C43, or Rosetta strains for rare codons).

  • What approaches can be used to study the interaction between atpG and other ATP synthase subunits?

    Multiple complementary techniques provide insight into subunit interactions:

    1. In vitro Reconstitution: Purified atpG can be combined with other purified subunits to reconstruct the peripheral stalk, followed by functional assays to confirm proper assembly.

    2. Yeast Two-Hybrid Analysis: Modified membrane yeast two-hybrid systems can identify direct protein-protein interactions between atpG and other subunits.

    3. Cross-linking Coupled with Mass Spectrometry: Chemical cross-linking followed by digestion and mass spectrometry can map interaction interfaces at the amino acid level.

    4. Surface Plasmon Resonance (SPR): Provides quantitative binding kinetics between immobilized atpG and other ATP synthase components.

    5. Cryo-Electron Microscopy: When combined with other subunits, structural analysis can reveal the precise position and interactions of atpG within the ATP synthase complex.

    6. FRET Analysis: Fluorescently labeled atpG and partner proteins can be used to study their interaction dynamics in real-time.

Research Applications

  • How can recombinant atpG be used to study bioenergetics in marine environments?

    Recombinant atpG offers several applications for marine bioenergetic research:

    1. Environmental Adaptation Studies: Compare the properties of atpG from Roseobacter strains isolated from different marine environments (coastal vs. open ocean, different depths) to understand bioenergetic adaptations.

    2. Climate Change Impact Assessment: Examine how atpG function is affected by environmental changes like ocean acidification and temperature increases, providing insights into how marine bacterial bioenergetics may respond to climate change.

    3. Synthetic Ecology Applications: As part of efforts to establish Roseobacter clade bacteria as synthetic biology chassis for biogeoengineering , atpG variants could be developed to optimize energy production under specific marine conditions.

    4. Biosensor Development: Engineer atpG-based sensors that can report on bioenergetic status in marine environments, potentially as part of environmental monitoring systems.

    5. Comparative Bioenergetics: Use atpG as a model to compare energy conservation mechanisms across diverse marine bacteria occupying different ecological niches.

  • What is the relationship between atpG function and the unusual metabolism of Roseobacter denitrificans?

    The atpG subunit plays a pivotal role in supporting the metabolic versatility of Roseobacter denitrificans:

    1. Integration of Energy Conservation Pathways: The ATP synthase complex containing atpG must efficiently couple to both photosynthetic and respiratory electron transport chains, requiring specialized structural features.

    2. Adaptation to Mixotrophic Carbon Fixation: Unlike typical phototrophs, Roseobacter denitrificans lacks genes for the Calvin cycle enzymes (RuBisCO and phosphoribulokinase) , instead using alternative CO₂ fixation pathways. The ATP synthase must function efficiently with these alternative pathways.

    3. Support for Multiple Terminal Electron Acceptors: Roseobacter denitrificans can use nitrate, nitrite, and trimethylamine N-oxide as terminal electron acceptors . The ATP synthase must maintain function across these varying redox conditions.

    4. Response to Photooxidative Stress: The unusual combination of aerobic growth and anoxygenic photosynthesis in Roseobacter denitrificans leads to increased singlet oxygen production . The ATP synthase complex, including atpG, must be resistant to this oxidative stress.

    5. Contribution to Carbon Metabolism: The genome of Roseobacter denitrificans suggests mixotrophic rather than autotrophic CO₂ fixation pathways , requiring the ATP synthase to function optimally under these hybrid metabolic conditions.

Future Research Directions

  • What are promising future research directions involving Roseobacter denitrificans atpG?

    Several promising research avenues include:

    1. Structure-Function Relationships: Determining the high-resolution structure of the complete ATP synthase complex from Roseobacter denitrificans would provide unprecedented insights into its unique adaptations.

    2. Synthetic Biology Applications: Engineering optimized atpG variants could enhance the potential of Roseobacter clade bacteria as chassis organisms for biogeoengineering applications .

    3. Environmental Adaptation Mechanisms: Investigating how atpG and the ATP synthase complex respond to changing ocean conditions could provide insights into bacterial adaptation to climate change.

    4. Comparative Analysis Across Roseobacter Species: Comparing atpG structure and function across the Roseobacter clade could reveal how ATP synthase has evolved to support different ecological strategies.

    5. Integration with Metabolic Models: Incorporating detailed ATP synthase kinetics into comprehensive metabolic models of Roseobacter denitrificans would enhance our understanding of energy flow in this important marine bacterium.

    6. Interspecies Energy Transfer: Investigating if ATP synthase components like atpG play roles in recently discovered interspecies energy transfer mechanisms in marine microbial communities.

  • How can cryo-EM techniques be applied to study the structural context of atpG in the intact ATP synthase complex?

    Cryo-electron microscopy offers powerful approaches for studying atpG in its native context:

    1. Sample Preparation Strategies:

      • Purify intact ATP synthase complexes from Roseobacter denitrificans membranes using gentle solubilization with appropriate detergents.

      • Alternatively, reconstitute the complex from individually purified components including recombinant atpG.

      • For membrane context studies, prepare nanodiscs containing the complete ATP synthase complex.

    2. Data Collection Optimization:

      • Use energy filters and phase plates to enhance contrast for this relatively small (~550 kDa) membrane protein complex.

      • Implement tilted data collection strategies to overcome preferred orientation issues common with membrane proteins.

    3. Processing Approaches:

      • Apply focused refinement techniques specifically targeting the peripheral stalk region containing atpG.

      • Use particle subtraction methods to enhance resolution of the atpG-containing regions.

      • Implement 3D variability analysis to capture different conformational states related to the catalytic cycle.

    4. Validation Methods:

      • Confirm subunit assignments using nanobody labeling targeted specifically to atpG.

      • Perform cross-linking mass spectrometry to validate interaction interfaces identified in cryo-EM models.

    5. Functional Correlation:

      • Correlate structural findings with functional assays of ATP synthesis/hydrolysis to connect structural features to mechanistic insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.