Construct: Full-length protein (1–200 amino acids) expressed with a His-tag for purification .
Storage: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose or 50% glycerol .
Lipid Production: Engineered Roseobacter strains expressing plsY could optimize lipid yields for biofuels or nutraceuticals .
Membrane Protein Studies: The recombinant protein serves as a model for understanding GPAT family dynamics and substrate specificity .
The Roseobacter denitrificans plsY sequence aligns with conserved GPAT domains:
Partial AA Sequence:
MIESTLPALALWGVIGYLLGSIPFGMVLAKVMGLGNLRDIGSGNIGATNVLRTGNKLAAA LTLVLDGGKGVVAVLAARAAGGEDLAQIAGLMAMIGHCYPVWLRFAGGKGVATFLGIVLA LAFPVGVGCCLAWLAGAFATRISSMGALVASVAAVPLAFLLGFPGAVVLLILLGALIFWR HRGNIARIRTGTEPKIGQKK
Expression Regulation
While Roseobacter strains lack photosynthetic pathways, plsY may be regulated by redox-sensitive transcription factors to balance lipid synthesis under varying metabolic conditions .
Apoptotic Links
In eukaryotes, GPAT2 silencing triggers apoptosis in germ cells , suggesting potential conserved roles in lipid-dependent cellular homeostasis.
KEGG: rde:RD1_3430
STRING: 375451.RD1_3430
Roseobacter denitrificans Glycerol-3-phosphate acyltransferase (plsY) is a membrane-associated enzyme from the marine aerobic photosynthetic bacterium Roseobacter denitrificans (strain ATCC 33942 / OCh 114, also referred to as Erythrobacter sp. strain OCh 114) . The enzyme is encoded by the plsY gene (locus name: RD1_3430) and has the UniProt accession number Q163C2 . PlsY belongs to the acyltransferase family and is classified with the Enzyme Commission number EC 2.3.1.n3 . The enzyme is alternatively known as Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, or G3P acyltransferase (GPAT) .
In the bacterial lipid synthesis pathway, Glycerol-3-phosphate acyltransferase (GPAT) catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis . Specifically, it catalyzes the conversion of glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid . This reaction represents the initial committed step in phospholipid and triglyceride biosynthesis in bacteria. In Roseobacter denitrificans, plsY plays a crucial role in membrane phospholipid synthesis, which is particularly important for this organism's adaptation to various environmental conditions as a marine photosynthetic bacterium .
For successful expression of R. denitrificans plsY, researchers should consider several expression systems depending on experimental objectives:
E. coli expression systems: Using E. coli strain W3110 with BioBrick-formatted plasmids such as pSB3C5 or pSB1C3 has proven effective for recombinant protein expression from Roseobacter species . These plasmids contain standardized restriction sites (EcoRI, NotI, XbaI, SpeI, and PstI) that facilitate modular cloning and expression .
Homologous expression: For native-like post-translational modifications, expression within Roseobacter strains themselves may be advantageous. Transformation protocols for Roseobacter species have been developed, though efficiency may be lower than with E. coli .
Specialized membrane protein expression systems: For improved yield and proper folding of membrane-associated proteins like plsY, consider systems optimized for membrane protein expression, such as C41(DE3) or C43(DE3) E. coli strains.
When expressing this membrane-associated protein, including appropriate fusion tags (His-tag, MBP, or SUMO) can improve solubility and facilitate purification .
Purification of active R. denitrificans plsY requires careful consideration of its membrane-associated nature. The following methodological approach is recommended:
Membrane fraction isolation: After cell lysis, separate membrane fractions using differential centrifugation (typically 100,000 × g for 1 hour).
Detergent solubilization: Solubilize membranes using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration.
Affinity chromatography: If the recombinant protein includes an affinity tag, use the corresponding affinity resin (e.g., Ni-NTA for His-tagged proteins).
Size exclusion chromatography: As a polishing step, remove aggregates and concentrate the protein using size exclusion chromatography with detergent in the mobile phase.
Activity preservation: Throughout purification, maintain a buffer system containing 50% glycerol and appropriate concentrations of detergent to prevent protein aggregation and preserve enzymatic activity .
The purified protein should be assessed for both purity (via SDS-PAGE) and activity (via enzymatic assays measuring lysophosphatidic acid formation).
To maintain maximum enzymatic activity, R. denitrificans plsY should be stored in the following conditions:
Short-term storage: For periods up to one week, store working aliquots at 4°C in a Tris-based buffer containing 50% glycerol, which has been optimized for this protein .
Long-term storage: For extended storage, maintain the protein at -20°C or preferably at -80°C .
Freeze-thaw considerations: Repeated freezing and thawing significantly reduces enzymatic activity and should be avoided . Prepare single-use aliquots before freezing to minimize freeze-thaw cycles.
Buffer composition: The storage buffer should include stabilizing agents such as glycerol (50%) and potentially low concentrations of reducing agents like DTT or β-mercaptoethanol to prevent oxidation of cysteine residues .
Cryopreservation evaluation: Studies on Roseobacter species have evaluated viability over 11 weeks of glycerol-based cryopreservation, suggesting this approach is effective for long-term storage .
Transformation of Roseobacter species, including R. denitrificans, presents unique challenges compared to model organisms. Based on research findings, the following methodological approaches have been tested:
Electroporation protocols: Researchers have tested a series of electroporation protocols for transformation of Roseobacter species including R. denitrificans, O. indolifex, and D. shibae . Optimization of field strength, pulse duration, and cell preparation methods is essential for success with this approach.
Heat shock transformation: Alternative to electroporation, heat shock protocols have also been investigated for Roseobacter species . These typically involve exposure to calcium chloride followed by a brief heat shock.
Plasmid selection: Chloramphenicol resistance has been used as a selection marker, with studies measuring chloramphenicol sensitivity of Roseobacter species prior to transformation . When selecting transformation vectors, compatibility with Roseobacter species should be considered.
Cell preparation: The physiological state of recipient cells significantly impacts transformation efficiency. Cells in early to mid-log phase typically yield higher transformation efficiencies.
Success in transformation of Roseobacter species opens possibilities for genetic manipulation, including expression of recombinant proteins like plsY or modification of native plsY gene .
For successful cloning and manipulation of the R. denitrificans plsY gene, researchers should consider the following methodological approach:
Primer design for BioBrick compatibility: Design primers that include appropriate restriction sites for BioBrick-formatted assembly. For example, forward primers should include EcoRI, NotI, and XbaI sites, while reverse primers should include SpeI, NotI, and PstI sites . This standardized approach enables recursive rounds of DNA ligation with consistent enzyme usage.
PCR amplification conditions: For amplification of genes from R. denitrificans, the following PCR protocol has proven effective:
Plasmid selection: BioBrick-formatted plasmids like pSB3C5 (EU496103) and pSB1C3 (AF532313) have been used successfully for cloning genes from Roseobacter species .
Restriction digestion and ligation: Standard molecular biology techniques can be used for restriction digests and ligations, with special attention to the BioBrick assembly format that enables plug-and-play strategies for genetic components .
Verification: After cloning, verify the integrity of the plsY gene through sequencing to ensure no mutations were introduced during PCR amplification.
This approach facilitates not only expression of recombinant plsY but also enables engineering modified versions of the enzyme for structure-function studies.
The kinetic parameters of R. denitrificans plsY provide critical insights into its catalytic efficiency and substrate preferences. Researchers should employ the following methodological approach to characterize these parameters:
Substrate saturation assays: Measure initial reaction rates at varying concentrations of both glycerol-3-phosphate and acyl-CoA substrates to determine Km and Vmax values for each substrate.
Activity assay methodology: Monitor the formation of lysophosphatidic acid using:
Radiolabeled substrates followed by thin-layer chromatography
Coupled enzyme assays measuring CoA release
HPLC or LC-MS detection of reaction products
Temperature-dependent kinetics: Analyze enzyme activity across a temperature range of 4-50°C, with particular attention to marine-relevant temperatures (10-30°C).
pH-dependent activity profile: Determine the pH optimum by measuring activity across a pH range of 5.0-9.0 using appropriate buffer systems.
Data analysis: Apply Michaelis-Menten kinetics to calculate key parameters:
| Parameter | Typical Range | Experimental Determination Method |
|---|---|---|
| Km (G3P) | 0.1-1.0 mM | Varying G3P at fixed acyl-CoA |
| Km (acyl-CoA) | 1-50 μM | Varying acyl-CoA at fixed G3P |
| kcat | 1-100 s⁻¹ | Rate at saturating substrate concentrations |
| kcat/Km | 10³-10⁶ M⁻¹s⁻¹ | Calculated from individual parameters |
These parameters allow comparison of R. denitrificans plsY with homologs from other bacterial species and provide insights into the enzyme's evolutionary adaptation to marine environments.
Understanding the substrate specificity of R. denitrificans plsY provides insights into its biological role and potential biotechnological applications. The following comparative analysis approach is recommended:
Acyl chain length preference: Test acyl-CoA substrates with varying chain lengths (C8-C22) to determine if R. denitrificans plsY shows preferences similar to other bacterial enzymes (typically C16-C18) or if it has adaptations specific to marine environments.
Saturation specificity: Compare activity with saturated versus unsaturated acyl chains to determine if the enzyme discriminates based on the presence of double bonds.
Comparison with mammalian GPATs: Unlike mammalian systems with four GPAT isoforms (GPAT1-4) that are divided between mitochondrial (GPAT1, GPAT2) and endoplasmic reticulum (GPAT3, GPAT4) localization , bacterial systems like R. denitrificans utilize a single plsY enzyme. This difference has implications for metabolic engineering and comparative biochemistry studies.
Structural basis for specificity: Through homology modeling or structural determination, identify residues that contribute to substrate binding and specificity. This can guide mutagenesis studies to alter specificity patterns.
Adaptive significance: Analyze how the specificity profile relates to the membrane composition of R. denitrificans and its adaptation to marine environments, particularly in how it may differ from terrestrial bacteria.
This comparative approach provides insights into the evolutionary adaptations of lipid metabolism enzymes across different domains of life and environmental niches.
The activity of R. denitrificans plsY is influenced by various environmental factors, reflecting the adaptive needs of this marine bacterium. Researchers should investigate these factors using the following methodological approach:
Temperature effects:
Marine environments experience temperature fluctuations that may impact enzyme activity
Measure activity at 5°C increments between 4-40°C to generate temperature-activity profiles
Calculate activation energy (Ea) using Arrhenius plots
Salinity dependence:
As a marine organism, R. denitrificans has adapted to saline conditions
Test enzyme activity across NaCl concentrations ranging from 0-1.0 M
Correlate optimal salinity with the natural habitat of Roseobacter species
Oxygen tension effects:
Light response:
Carbon source influence:
Oxidative stress response:
This comprehensive analysis provides insights into how R. denitrificans adapts its lipid metabolism to varying environmental conditions, which is crucial for understanding its ecological niche.
Genetic manipulation of R. denitrificans plsY offers powerful approaches to investigate membrane adaptation mechanisms in marine environments. Researchers should consider the following methodological approaches:
Site-directed mutagenesis: Target conserved residues in plsY to alter substrate specificity or catalytic efficiency. This can reveal:
Which amino acids are essential for substrate recognition
How alterations in acyl chain incorporation affect membrane properties
The minimal activity required for viability
Regulated expression systems: Develop inducible promoters for Roseobacter to control plsY expression levels, enabling:
Assessment of how plsY expression levels impact membrane composition
Investigation of compensatory mechanisms when plsY activity is limited
Identification of rate-limiting steps in phospholipid biosynthesis
Reporter fusions: Create plsY-reporter gene fusions to monitor expression patterns in response to:
Heterologous complementation: Express R. denitrificans plsY in other bacterial species with plsY mutations to:
Assess functional conservation across bacterial lineages
Identify unique adaptations specific to marine Roseobacter strains
Study membrane engineering possibilities in biotechnologically relevant bacteria
Integration with systems biology: Combine plsY manipulation with transcriptomics and lipidomics to:
These approaches can reveal how marine bacteria like R. denitrificans have adapted their membrane composition to thrive in their specific ecological niches.
R. denitrificans is an aerobic photosynthetic bacterium that must balance phototrophy with oxidative stress management, with membrane composition playing a crucial role in this balance. Based on research findings, the following methodological investigation approach is recommended:
Comparative transcriptomics: Analyze co-expression patterns between:
plsY and photosystem components
plsY and oxidative stress response genes
plsY and carbon metabolism pathways
Metabolic analysis: Investigate how different carbon sources affect:
plsY expression and activity
Membrane composition
Phototrophy advantage
Studies have shown that phototrophy provides a growth advantage to wild-type cells grown on glucose but not on butyrate . This suggests complex integration between carbon metabolism, phototrophy, and potentially membrane composition.
Targeted gene knockout studies: Create mutants with altered:
Membrane composition analysis: Compare phospholipid profiles between:
Cells grown in light versus dark conditions
Cells under oxidative stress versus normal conditions
Wild-type versus plsY-modified strains
Integration with regulatory networks: Investigate the role of key regulators like ppsR, which has been demonstrated as a key regulator of phototrophy through targeted gene knockout . This regulator may indirectly affect plsY expression through coordinated control of membrane composition.
This integrated approach can reveal how R. denitrificans coordinates membrane lipid composition (through plsY activity) with photosynthetic capacity and oxidative stress management, providing insights into the adaptive strategies of marine phototrophs.
R. denitrificans plsY offers promising opportunities for metabolic engineering with applications in biofuel production, environmental remediation, and specialized lipid synthesis. Researchers should consider the following methodological approaches:
Engineered lipid production: Manipulate plsY along with other lipid biosynthesis genes to:
Alter membrane phospholipid composition for biofuel precursor production
Create strains with enhanced production of specific fatty acid profiles
Develop marine-derived platforms for sustainable lipid production
Enhanced environmental applications: Engineer Roseobacter strains with modified plsY to address:
Synthetic biology approaches: Apply BioBrick-compatible design principles to:
Stress-resistant strain development: Engineer strains with modified plsY activity to:
Cold adaptation engineering: Explore the combination of plsY modifications with cold adaptation genes like anf1 (antifreeze protein type I) from related organisms like O. indolifex to:
Develop strains with enhanced cold tolerance
Create production platforms functional at lower temperatures
Transfer cold tolerance traits to other industrially relevant organisms
These applications leverage the unique properties of R. denitrificans plsY within synthetic biology frameworks to address biotechnological challenges, particularly those relevant to marine environments.
Researchers working with R. denitrificans plsY often encounter several experimental challenges. The following methodological approaches can help overcome these difficulties:
Low expression levels:
Optimize codon usage for the expression host
Test multiple promoter strengths and induction conditions
Evaluate expression in specialized strains designed for membrane proteins
Consider fusion partners that enhance expression (MBP, SUMO, Thioredoxin)
Protein misfolding and inclusion body formation:
Lower induction temperature (16-20°C) to slow protein synthesis and improve folding
Include chemical chaperones in the growth medium (glycerol, sucrose, arginine)
Co-express molecular chaperones (GroEL/ES, DnaK/J)
Develop refolding protocols if inclusion bodies are unavoidable
Membrane association difficulties:
Use mild detergents for extraction (DDM, LDAO, OG)
Optimize detergent:protein ratio to prevent aggregation
Consider nanodiscs or liposomes for maintaining native-like membrane environment
Test detergent screens to identify optimal solubilization conditions
Low enzymatic activity:
Purification challenges:
Implement two-phase purification strategies (affinity followed by size exclusion)
Consider on-column refolding for challenging preparations
Validate activity at each purification step to identify problematic conditions
Optimize buffer compositions to maintain stability during concentration steps
By addressing these common challenges systematically, researchers can improve the yield and quality of recombinant R. denitrificans plsY preparations for subsequent enzymatic and structural studies.
Transformation of Roseobacter species presents unique challenges compared to model organisms like E. coli. The following evidence-based methodological approaches can help overcome these limitations:
Optimize electroporation conditions:
Test multiple field strengths (1.5-2.5 kV/cm)
Vary pulse duration and capacitance settings
Optimize cell density and growth phase (typically early to mid-log phase)
Use specialized electroporation buffers with reduced salt concentration
Heat shock protocol optimization:
Test variations in calcium chloride concentration (50-100 mM)
Modify heat shock duration (30-90 seconds) and temperature (37-42°C)
Include recovery periods in rich media before selective plating
Restriction barrier circumvention:
Isolate plasmid DNA from Roseobacter strains when possible to avoid restriction
Use DNA isolated from methylation-deficient E. coli strains
Identify and account for specific restriction systems in Roseobacter
Plasmid design considerations:
Cell preparation improvements:
Grow cells in marine broth or defined marine media
Harvest at optimal density (OD600 0.4-0.6)
Include multiple washing steps to remove salts and extracellular polysaccharides
Test glycine treatment to weaken cell walls
Recovery optimization:
Use extended recovery periods (3-16 hours)
Optimize recovery temperature (20-30°C depending on species)
Test recovery media compositions (marine broth, SOC with sea salts)
These methodological improvements directly address the challenges identified in previous research on transformation of Roseobacter species, including R. denitrificans, O. indolifex, and D. shibae .
Ensuring specificity and reproducibility in plsY activity assays is critical for meaningful enzymatic characterization. Researchers should implement the following methodological controls and considerations:
Substrate purity verification:
Analyze glycerol-3-phosphate and acyl-CoA substrates by HPLC before use
Prepare fresh acyl-CoA solutions to avoid hydrolysis products
Consider synthesizing defined acyl-donor substrates for consistency
Enzyme quality controls:
Implement batch-to-batch consistency checks using standard substrate conditions
Verify purity by SDS-PAGE and activity correlation
Monitor stability during storage using activity retention measurements
Assay specificity controls:
Include heat-inactivated enzyme controls
Use specific inhibitors to confirm on-target activity
Test activity with substrate analogs to confirm specificity
Implement negative controls with related but inactive proteins
Reaction condition standardization:
Precisely control temperature during assays (±0.5°C)
Use buffering systems with minimal temperature dependence
Carefully control detergent concentrations, which can affect activity
Standardize mixing and sampling procedures
Product detection method validation:
For radiometric assays: establish extraction efficiency and counting consistency
For HPLC/LC-MS methods: validate linear range, limit of detection, and reproducibility
For coupled enzyme assays: verify coupling enzyme excess and stability
Data analysis standardization:
Implement consistent methods for initial rate determination
Use appropriate enzyme kinetic models (Michaelis-Menten, allosteric)
Apply statistical analyses to determine significance of parametric differences
Report complete experimental conditions to enable reproduction
| Parameter | Potential Variability Source | Control Measure |
|---|---|---|
| Temperature | Affects reaction rate | Water bath/block with ±0.5°C stability |
| pH | Affects ionization state of active site | Temperature-stable buffers |
| Substrate quality | Degraded substrates reduce activity | HPLC verification before use |
| Detergent concentration | Affects enzyme conformation | Precise preparation, CMC monitoring |
| Product detection | Method-specific variability | Calibration curves with authentic standards |
| Enzyme stability | Activity loss during assay | Time-course stability controls |
Implementing these methodological controls ensures that observed differences in plsY activity reflect true biological parameters rather than experimental artifacts.