Recombinant Roseobacter denitrificans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Expression in E. coli

  • Construct: Full-length protein (1–200 amino acids) expressed with a His-tag for purification .

  • Storage: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose or 50% glycerol .

  • Purity: >90% as confirmed by SDS-PAGE .

Biotechnological Potential

  • Lipid Production: Engineered Roseobacter strains expressing plsY could optimize lipid yields for biofuels or nutraceuticals .

  • Membrane Protein Studies: The recombinant protein serves as a model for understanding GPAT family dynamics and substrate specificity .

Amino Acid Sequence and Conserved Motifs

The Roseobacter denitrificans plsY sequence aligns with conserved GPAT domains:
Partial AA Sequence:
MIESTLPALALWGVIGYLLGSIPFGMVLAKVMGLGNLRDIGSGNIGATNVLRTGNKLAAA LTLVLDGGKGVVAVLAARAAGGEDLAQIAGLMAMIGHCYPVWLRFAGGKGVATFLGIVLA LAFPVGVGCCLAWLAGAFATRISSMGALVASVAAVPLAFLLGFPGAVVLLILLGALIFWR HRGNIARIRTGTEPKIGQKK

Regulatory and Functional Insights

Expression Regulation
While Roseobacter strains lack photosynthetic pathways, plsY may be regulated by redox-sensitive transcription factors to balance lipid synthesis under varying metabolic conditions .

Apoptotic Links
In eukaryotes, GPAT2 silencing triggers apoptosis in germ cells , suggesting potential conserved roles in lipid-dependent cellular homeostasis.

Comparative Analysis with Other GPATs

IsoformLocalizationSubstrate PreferenceRegulatory Role
GPAT1 (Mammalian)Endoplasmic reticulumUnsaturated acyl-CoASREBP-1c-regulated
GPAT2 (Mammalian)Mitochondria/ERSaturated acyl-CoAEpigenetic control in germ cells
plsY (R. denitrificans)Membrane-boundAcyl-phosphateMixotrophic lipid synthesis

Challenges and Future Directions

  • Activity Optimization: Mutagenesis studies are needed to enhance catalytic efficiency or substrate specificity .

  • Plasmid Compatibility: Roseobacter strains require ≥17 µg/mL chloramphenicol for plasmid selection, limiting genetic manipulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; RD1_3430; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)
Target Names
plsY
Target Protein Sequence
MIESTLPALALWGVIGYLLGSIPFGMVLAKVMGLGNLRDIGSGNIGATNVLRTGNKLAAA LTLVLDGGKGVVAVLAARAAGGEDLAQIAGLMAMIGHCYPVWLRFAGGKGVATFLGIVLA LAFPVGVGCCLAWLAGAFATRISSMGALVASVAAVPLAFLLGFPGAVVLLILLGALIFWR HRGNIARIRTGTEPKIGQKK
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Roseobacter denitrificans Glycerol-3-phosphate acyltransferase (plsY) and how is it classified?

Roseobacter denitrificans Glycerol-3-phosphate acyltransferase (plsY) is a membrane-associated enzyme from the marine aerobic photosynthetic bacterium Roseobacter denitrificans (strain ATCC 33942 / OCh 114, also referred to as Erythrobacter sp. strain OCh 114) . The enzyme is encoded by the plsY gene (locus name: RD1_3430) and has the UniProt accession number Q163C2 . PlsY belongs to the acyltransferase family and is classified with the Enzyme Commission number EC 2.3.1.n3 . The enzyme is alternatively known as Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, or G3P acyltransferase (GPAT) .

What is the primary function of bacterial Glycerol-3-phosphate acyltransferase in lipid metabolism?

In the bacterial lipid synthesis pathway, Glycerol-3-phosphate acyltransferase (GPAT) catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis . Specifically, it catalyzes the conversion of glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid . This reaction represents the initial committed step in phospholipid and triglyceride biosynthesis in bacteria. In Roseobacter denitrificans, plsY plays a crucial role in membrane phospholipid synthesis, which is particularly important for this organism's adaptation to various environmental conditions as a marine photosynthetic bacterium .

What are the recommended expression systems for recombinant production of R. denitrificans plsY?

For successful expression of R. denitrificans plsY, researchers should consider several expression systems depending on experimental objectives:

  • E. coli expression systems: Using E. coli strain W3110 with BioBrick-formatted plasmids such as pSB3C5 or pSB1C3 has proven effective for recombinant protein expression from Roseobacter species . These plasmids contain standardized restriction sites (EcoRI, NotI, XbaI, SpeI, and PstI) that facilitate modular cloning and expression .

  • Homologous expression: For native-like post-translational modifications, expression within Roseobacter strains themselves may be advantageous. Transformation protocols for Roseobacter species have been developed, though efficiency may be lower than with E. coli .

  • Specialized membrane protein expression systems: For improved yield and proper folding of membrane-associated proteins like plsY, consider systems optimized for membrane protein expression, such as C41(DE3) or C43(DE3) E. coli strains.

When expressing this membrane-associated protein, including appropriate fusion tags (His-tag, MBP, or SUMO) can improve solubility and facilitate purification .

What purification strategies yield the highest activity for recombinant R. denitrificans plsY?

Purification of active R. denitrificans plsY requires careful consideration of its membrane-associated nature. The following methodological approach is recommended:

  • Membrane fraction isolation: After cell lysis, separate membrane fractions using differential centrifugation (typically 100,000 × g for 1 hour).

  • Detergent solubilization: Solubilize membranes using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration.

  • Affinity chromatography: If the recombinant protein includes an affinity tag, use the corresponding affinity resin (e.g., Ni-NTA for His-tagged proteins).

  • Size exclusion chromatography: As a polishing step, remove aggregates and concentrate the protein using size exclusion chromatography with detergent in the mobile phase.

  • Activity preservation: Throughout purification, maintain a buffer system containing 50% glycerol and appropriate concentrations of detergent to prevent protein aggregation and preserve enzymatic activity .

The purified protein should be assessed for both purity (via SDS-PAGE) and activity (via enzymatic assays measuring lysophosphatidic acid formation).

What are the optimal storage conditions for preserving activity of recombinant R. denitrificans plsY?

To maintain maximum enzymatic activity, R. denitrificans plsY should be stored in the following conditions:

  • Short-term storage: For periods up to one week, store working aliquots at 4°C in a Tris-based buffer containing 50% glycerol, which has been optimized for this protein .

  • Long-term storage: For extended storage, maintain the protein at -20°C or preferably at -80°C .

  • Freeze-thaw considerations: Repeated freezing and thawing significantly reduces enzymatic activity and should be avoided . Prepare single-use aliquots before freezing to minimize freeze-thaw cycles.

  • Buffer composition: The storage buffer should include stabilizing agents such as glycerol (50%) and potentially low concentrations of reducing agents like DTT or β-mercaptoethanol to prevent oxidation of cysteine residues .

  • Cryopreservation evaluation: Studies on Roseobacter species have evaluated viability over 11 weeks of glycerol-based cryopreservation, suggesting this approach is effective for long-term storage .

What transformation protocols are most effective for introducing recombinant plsY constructs into Roseobacter species?

Transformation of Roseobacter species, including R. denitrificans, presents unique challenges compared to model organisms. Based on research findings, the following methodological approaches have been tested:

  • Electroporation protocols: Researchers have tested a series of electroporation protocols for transformation of Roseobacter species including R. denitrificans, O. indolifex, and D. shibae . Optimization of field strength, pulse duration, and cell preparation methods is essential for success with this approach.

  • Heat shock transformation: Alternative to electroporation, heat shock protocols have also been investigated for Roseobacter species . These typically involve exposure to calcium chloride followed by a brief heat shock.

  • Plasmid selection: Chloramphenicol resistance has been used as a selection marker, with studies measuring chloramphenicol sensitivity of Roseobacter species prior to transformation . When selecting transformation vectors, compatibility with Roseobacter species should be considered.

  • Cell preparation: The physiological state of recipient cells significantly impacts transformation efficiency. Cells in early to mid-log phase typically yield higher transformation efficiencies.

Success in transformation of Roseobacter species opens possibilities for genetic manipulation, including expression of recombinant proteins like plsY or modification of native plsY gene .

What cloning strategies are recommended for amplifying and manipulating the plsY gene from R. denitrificans?

For successful cloning and manipulation of the R. denitrificans plsY gene, researchers should consider the following methodological approach:

  • Primer design for BioBrick compatibility: Design primers that include appropriate restriction sites for BioBrick-formatted assembly. For example, forward primers should include EcoRI, NotI, and XbaI sites, while reverse primers should include SpeI, NotI, and PstI sites . This standardized approach enables recursive rounds of DNA ligation with consistent enzyme usage.

  • PCR amplification conditions: For amplification of genes from R. denitrificans, the following PCR protocol has proven effective:

    • Initial denaturation at 94°C for 2 min

    • 28 cycles of: denaturation at 94°C for 1.5 min, annealing at 55°C for 1 min, extension at 72°C for 40 s

    • Final extension at 72°C

  • Plasmid selection: BioBrick-formatted plasmids like pSB3C5 (EU496103) and pSB1C3 (AF532313) have been used successfully for cloning genes from Roseobacter species .

  • Restriction digestion and ligation: Standard molecular biology techniques can be used for restriction digests and ligations, with special attention to the BioBrick assembly format that enables plug-and-play strategies for genetic components .

  • Verification: After cloning, verify the integrity of the plsY gene through sequencing to ensure no mutations were introduced during PCR amplification.

This approach facilitates not only expression of recombinant plsY but also enables engineering modified versions of the enzyme for structure-function studies.

What kinetic parameters characterize R. denitrificans plsY activity and how can they be experimentally determined?

The kinetic parameters of R. denitrificans plsY provide critical insights into its catalytic efficiency and substrate preferences. Researchers should employ the following methodological approach to characterize these parameters:

  • Substrate saturation assays: Measure initial reaction rates at varying concentrations of both glycerol-3-phosphate and acyl-CoA substrates to determine Km and Vmax values for each substrate.

  • Activity assay methodology: Monitor the formation of lysophosphatidic acid using:

    • Radiolabeled substrates followed by thin-layer chromatography

    • Coupled enzyme assays measuring CoA release

    • HPLC or LC-MS detection of reaction products

  • Temperature-dependent kinetics: Analyze enzyme activity across a temperature range of 4-50°C, with particular attention to marine-relevant temperatures (10-30°C).

  • pH-dependent activity profile: Determine the pH optimum by measuring activity across a pH range of 5.0-9.0 using appropriate buffer systems.

  • Data analysis: Apply Michaelis-Menten kinetics to calculate key parameters:

ParameterTypical RangeExperimental Determination Method
Km (G3P)0.1-1.0 mMVarying G3P at fixed acyl-CoA
Km (acyl-CoA)1-50 μMVarying acyl-CoA at fixed G3P
kcat1-100 s⁻¹Rate at saturating substrate concentrations
kcat/Km10³-10⁶ M⁻¹s⁻¹Calculated from individual parameters

These parameters allow comparison of R. denitrificans plsY with homologs from other bacterial species and provide insights into the enzyme's evolutionary adaptation to marine environments.

How does substrate specificity of R. denitrificans plsY compare with other bacterial and mammalian GPAT enzymes?

Understanding the substrate specificity of R. denitrificans plsY provides insights into its biological role and potential biotechnological applications. The following comparative analysis approach is recommended:

  • Acyl chain length preference: Test acyl-CoA substrates with varying chain lengths (C8-C22) to determine if R. denitrificans plsY shows preferences similar to other bacterial enzymes (typically C16-C18) or if it has adaptations specific to marine environments.

  • Saturation specificity: Compare activity with saturated versus unsaturated acyl chains to determine if the enzyme discriminates based on the presence of double bonds.

  • Comparison with mammalian GPATs: Unlike mammalian systems with four GPAT isoforms (GPAT1-4) that are divided between mitochondrial (GPAT1, GPAT2) and endoplasmic reticulum (GPAT3, GPAT4) localization , bacterial systems like R. denitrificans utilize a single plsY enzyme. This difference has implications for metabolic engineering and comparative biochemistry studies.

  • Structural basis for specificity: Through homology modeling or structural determination, identify residues that contribute to substrate binding and specificity. This can guide mutagenesis studies to alter specificity patterns.

  • Adaptive significance: Analyze how the specificity profile relates to the membrane composition of R. denitrificans and its adaptation to marine environments, particularly in how it may differ from terrestrial bacteria.

This comparative approach provides insights into the evolutionary adaptations of lipid metabolism enzymes across different domains of life and environmental niches.

What environmental factors most significantly impact R. denitrificans plsY activity and how can these effects be quantified?

The activity of R. denitrificans plsY is influenced by various environmental factors, reflecting the adaptive needs of this marine bacterium. Researchers should investigate these factors using the following methodological approach:

  • Temperature effects:

    • Marine environments experience temperature fluctuations that may impact enzyme activity

    • Measure activity at 5°C increments between 4-40°C to generate temperature-activity profiles

    • Calculate activation energy (Ea) using Arrhenius plots

  • Salinity dependence:

    • As a marine organism, R. denitrificans has adapted to saline conditions

    • Test enzyme activity across NaCl concentrations ranging from 0-1.0 M

    • Correlate optimal salinity with the natural habitat of Roseobacter species

  • Oxygen tension effects:

    • As an aerobic anoxygenic photosynthetic bacterium , R. denitrificans may show oxygen-dependent regulation

    • Compare enzyme activity under aerobic, microaerobic, and anaerobic conditions

    • Correlate with the expression of photosynthetic machinery genes which may be co-regulated with lipid metabolism

  • Light response:

    • Investigate whether light exposure affects enzyme activity or expression

    • Studies have shown that light can enhance growth in Roseobacter species when grown on certain carbon sources like glucose

    • This effect may be linked to changes in membrane composition requiring plsY activity

  • Carbon source influence:

    • Growth on different carbon sources (e.g., glucose vs. butyrate) affects phototrophy and potentially membrane composition

    • Measure plsY activity in cells grown on different carbon sources to identify metabolic integration

  • Oxidative stress response:

    • Reactive oxygen species (ROS) have been identified as a strong selective pressure for Roseobacter

    • Investigate how oxidative stress affects plsY activity and expression

    • Connect to the broader oxidative stress response mediated by catalase/peroxidase and oxyR

This comprehensive analysis provides insights into how R. denitrificans adapts its lipid metabolism to varying environmental conditions, which is crucial for understanding its ecological niche.

How can genetic manipulation of R. denitrificans plsY contribute to understanding membrane adaptation in marine bacteria?

Genetic manipulation of R. denitrificans plsY offers powerful approaches to investigate membrane adaptation mechanisms in marine environments. Researchers should consider the following methodological approaches:

  • Site-directed mutagenesis: Target conserved residues in plsY to alter substrate specificity or catalytic efficiency. This can reveal:

    • Which amino acids are essential for substrate recognition

    • How alterations in acyl chain incorporation affect membrane properties

    • The minimal activity required for viability

  • Regulated expression systems: Develop inducible promoters for Roseobacter to control plsY expression levels, enabling:

    • Assessment of how plsY expression levels impact membrane composition

    • Investigation of compensatory mechanisms when plsY activity is limited

    • Identification of rate-limiting steps in phospholipid biosynthesis

  • Reporter fusions: Create plsY-reporter gene fusions to monitor expression patterns in response to:

    • Temperature fluctuations typical of marine environments

    • Nutrient limitation scenarios

    • Varying light conditions that affect photosynthetic activity

  • Heterologous complementation: Express R. denitrificans plsY in other bacterial species with plsY mutations to:

    • Assess functional conservation across bacterial lineages

    • Identify unique adaptations specific to marine Roseobacter strains

    • Study membrane engineering possibilities in biotechnologically relevant bacteria

  • Integration with systems biology: Combine plsY manipulation with transcriptomics and lipidomics to:

    • Map the regulatory networks controlling membrane composition

    • Identify co-regulated genes in response to environmental stressors

    • Understand the integration of phototrophy, carbon metabolism, and membrane homeostasis

These approaches can reveal how marine bacteria like R. denitrificans have adapted their membrane composition to thrive in their specific ecological niches.

What is the relationship between plsY activity, phototrophy, and oxidative stress in R. denitrificans?

R. denitrificans is an aerobic photosynthetic bacterium that must balance phototrophy with oxidative stress management, with membrane composition playing a crucial role in this balance. Based on research findings, the following methodological investigation approach is recommended:

  • Comparative transcriptomics: Analyze co-expression patterns between:

    • plsY and photosystem components

    • plsY and oxidative stress response genes

    • plsY and carbon metabolism pathways

  • Metabolic analysis: Investigate how different carbon sources affect:

    • plsY expression and activity

    • Membrane composition

    • Phototrophy advantage

    Studies have shown that phototrophy provides a growth advantage to wild-type cells grown on glucose but not on butyrate . This suggests complex integration between carbon metabolism, phototrophy, and potentially membrane composition.

  • Targeted gene knockout studies: Create mutants with altered:

    • plsY expression levels

    • Photosystem components

    • ROS detoxification systems (e.g., catalase/peroxidase, oxyR)

  • Membrane composition analysis: Compare phospholipid profiles between:

    • Cells grown in light versus dark conditions

    • Cells under oxidative stress versus normal conditions

    • Wild-type versus plsY-modified strains

  • Integration with regulatory networks: Investigate the role of key regulators like ppsR, which has been demonstrated as a key regulator of phototrophy through targeted gene knockout . This regulator may indirectly affect plsY expression through coordinated control of membrane composition.

This integrated approach can reveal how R. denitrificans coordinates membrane lipid composition (through plsY activity) with photosynthetic capacity and oxidative stress management, providing insights into the adaptive strategies of marine phototrophs.

How can R. denitrificans plsY be utilized in metabolic engineering for biotechnological applications?

R. denitrificans plsY offers promising opportunities for metabolic engineering with applications in biofuel production, environmental remediation, and specialized lipid synthesis. Researchers should consider the following methodological approaches:

  • Engineered lipid production: Manipulate plsY along with other lipid biosynthesis genes to:

    • Alter membrane phospholipid composition for biofuel precursor production

    • Create strains with enhanced production of specific fatty acid profiles

    • Develop marine-derived platforms for sustainable lipid production

  • Enhanced environmental applications: Engineer Roseobacter strains with modified plsY to address:

    • Plastic remediation through co-expression with laccases that can degrade polyethylene

    • Bioremediation of marine pollutants through altered membrane permeability

    • Climate change mitigation strategies leveraging Roseobacter's marine niche

  • Synthetic biology approaches: Apply BioBrick-compatible design principles to:

    • Create standardized expression modules for plsY and associated lipid biosynthesis genes

    • Develop orthogonal lipid biosynthesis pathways that don't interfere with native metabolism

    • Combine plsY with synthetic regulatory circuits responsive to environmental signals

  • Stress-resistant strain development: Engineer strains with modified plsY activity to:

    • Enhance tolerance to temperature extremes through altered membrane fluidity

    • Improve resistance to oxidative stress, which is a key selective pressure for Roseobacter

    • Develop robust chassis organisms for biotechnological applications in marine environments

  • Cold adaptation engineering: Explore the combination of plsY modifications with cold adaptation genes like anf1 (antifreeze protein type I) from related organisms like O. indolifex to:

    • Develop strains with enhanced cold tolerance

    • Create production platforms functional at lower temperatures

    • Transfer cold tolerance traits to other industrially relevant organisms

These applications leverage the unique properties of R. denitrificans plsY within synthetic biology frameworks to address biotechnological challenges, particularly those relevant to marine environments.

What are the most common challenges in expressing and purifying active R. denitrificans plsY and how can they be addressed?

Researchers working with R. denitrificans plsY often encounter several experimental challenges. The following methodological approaches can help overcome these difficulties:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test multiple promoter strengths and induction conditions

    • Evaluate expression in specialized strains designed for membrane proteins

    • Consider fusion partners that enhance expression (MBP, SUMO, Thioredoxin)

  • Protein misfolding and inclusion body formation:

    • Lower induction temperature (16-20°C) to slow protein synthesis and improve folding

    • Include chemical chaperones in the growth medium (glycerol, sucrose, arginine)

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Develop refolding protocols if inclusion bodies are unavoidable

  • Membrane association difficulties:

    • Use mild detergents for extraction (DDM, LDAO, OG)

    • Optimize detergent:protein ratio to prevent aggregation

    • Consider nanodiscs or liposomes for maintaining native-like membrane environment

    • Test detergent screens to identify optimal solubilization conditions

  • Low enzymatic activity:

    • Ensure preserving enzyme in 50% glycerol as recommended

    • Maintain reducing conditions to prevent oxidation of critical cysteine residues

    • Include appropriate metal cofactors if required

    • Minimize freeze-thaw cycles as they significantly reduce activity

  • Purification challenges:

    • Implement two-phase purification strategies (affinity followed by size exclusion)

    • Consider on-column refolding for challenging preparations

    • Validate activity at each purification step to identify problematic conditions

    • Optimize buffer compositions to maintain stability during concentration steps

By addressing these common challenges systematically, researchers can improve the yield and quality of recombinant R. denitrificans plsY preparations for subsequent enzymatic and structural studies.

What strategies can improve transformation efficiency when working with Roseobacter species?

Transformation of Roseobacter species presents unique challenges compared to model organisms like E. coli. The following evidence-based methodological approaches can help overcome these limitations:

  • Optimize electroporation conditions:

    • Test multiple field strengths (1.5-2.5 kV/cm)

    • Vary pulse duration and capacitance settings

    • Optimize cell density and growth phase (typically early to mid-log phase)

    • Use specialized electroporation buffers with reduced salt concentration

  • Heat shock protocol optimization:

    • Test variations in calcium chloride concentration (50-100 mM)

    • Modify heat shock duration (30-90 seconds) and temperature (37-42°C)

    • Include recovery periods in rich media before selective plating

  • Restriction barrier circumvention:

    • Isolate plasmid DNA from Roseobacter strains when possible to avoid restriction

    • Use DNA isolated from methylation-deficient E. coli strains

    • Identify and account for specific restriction systems in Roseobacter

  • Plasmid design considerations:

    • Use plasmids with broad-host-range origins of replication

    • Test multiple antibiotic selection markers (research has evaluated chloramphenicol sensitivity)

    • Incorporate Roseobacter-derived promoters for reliable expression

  • Cell preparation improvements:

    • Grow cells in marine broth or defined marine media

    • Harvest at optimal density (OD600 0.4-0.6)

    • Include multiple washing steps to remove salts and extracellular polysaccharides

    • Test glycine treatment to weaken cell walls

  • Recovery optimization:

    • Use extended recovery periods (3-16 hours)

    • Optimize recovery temperature (20-30°C depending on species)

    • Test recovery media compositions (marine broth, SOC with sea salts)

These methodological improvements directly address the challenges identified in previous research on transformation of Roseobacter species, including R. denitrificans, O. indolifex, and D. shibae .

How can researchers address specificity and reproducibility issues in plsY activity assays?

Ensuring specificity and reproducibility in plsY activity assays is critical for meaningful enzymatic characterization. Researchers should implement the following methodological controls and considerations:

  • Substrate purity verification:

    • Analyze glycerol-3-phosphate and acyl-CoA substrates by HPLC before use

    • Prepare fresh acyl-CoA solutions to avoid hydrolysis products

    • Consider synthesizing defined acyl-donor substrates for consistency

  • Enzyme quality controls:

    • Implement batch-to-batch consistency checks using standard substrate conditions

    • Verify purity by SDS-PAGE and activity correlation

    • Monitor stability during storage using activity retention measurements

  • Assay specificity controls:

    • Include heat-inactivated enzyme controls

    • Use specific inhibitors to confirm on-target activity

    • Test activity with substrate analogs to confirm specificity

    • Implement negative controls with related but inactive proteins

  • Reaction condition standardization:

    • Precisely control temperature during assays (±0.5°C)

    • Use buffering systems with minimal temperature dependence

    • Carefully control detergent concentrations, which can affect activity

    • Standardize mixing and sampling procedures

  • Product detection method validation:

    • For radiometric assays: establish extraction efficiency and counting consistency

    • For HPLC/LC-MS methods: validate linear range, limit of detection, and reproducibility

    • For coupled enzyme assays: verify coupling enzyme excess and stability

  • Data analysis standardization:

    • Implement consistent methods for initial rate determination

    • Use appropriate enzyme kinetic models (Michaelis-Menten, allosteric)

    • Apply statistical analyses to determine significance of parametric differences

    • Report complete experimental conditions to enable reproduction

ParameterPotential Variability SourceControl Measure
TemperatureAffects reaction rateWater bath/block with ±0.5°C stability
pHAffects ionization state of active siteTemperature-stable buffers
Substrate qualityDegraded substrates reduce activityHPLC verification before use
Detergent concentrationAffects enzyme conformationPrecise preparation, CMC monitoring
Product detectionMethod-specific variabilityCalibration curves with authentic standards
Enzyme stabilityActivity loss during assayTime-course stability controls

Implementing these methodological controls ensures that observed differences in plsY activity reflect true biological parameters rather than experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.