Recombinant Roseobacter denitrificans Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

YidC facilitates membrane protein insertion via:

  1. Co-translational Interaction: Binds ribosomes at the tunnel exit, guiding nascent polypeptides into the membrane .

  2. Lipid Bilayer Thinning: Reduces energy barriers for insertion through its hydrophilic groove .

  3. Chaperone Activity: Assists in the folding of transmembrane domains .

Substrate Specificity

  • YidC preferentially inserts Sec-independent substrates (e.g., Pf3 coat, M13 procoat) but collaborates with SecYEG for complex proteins like F0c .

  • Mutations in the hydrophobic slide (e.g., YidC-5S) disrupt SecYEG interaction, impairing ATP synthase assembly .

Conformational Dynamics

  • Molecular dynamics simulations reveal YidC flexibility during substrate insertion, particularly in the C2 loop and PD .

  • Pf3 coat protein insertion induces bending angles of ~30°, altering YidC’s groove environment .

Interactome and Accessory Factors

  • YibN: A newly identified interactor in E. coli, enhancing YidC-mediated insertion of substrates like SecG and F0c .

  • Lipid Scramblase Activity: Linked to YidC’s hydrophilic groove, facilitating lipid reorganization during insertion .

Implications for Roseobacter denitrificans

Roseobacter denitrificans is a metabolically versatile marine bacterium with aerobic anoxygenic phototrophy and denitrification capabilities . While its YidC remains uncharacterized, genomic analyses suggest:

  • Phototrophic Gene Cluster (PGC): Synteny with Rhodobacter species implies YidC’s role in assembling photosynthetic machinery .

  • CO Oxidation and Phosphonate Metabolism: YidC may support membrane protein integration for these pathways .

Future Research Directions

  1. Heterologous Expression: Cloning and purification of Roseobacter denitrificans YidC for structural studies (e.g., cryo-EM).

  2. Functional Assays: Testing substrate specificity using in vitro reconstitution .

  3. Ecological Role: Investigating YidC’s contribution to marine nutrient cycling and phototrophy.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
yidC; RD1_1455; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
full length protein
Species
Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)
Target Names
yidC
Target Protein Sequence
MDDQNKNLILATALSFIVILVWFVLFPPPEPEMPLTGETSTELTPDAATGSLPSVTSDTA PSVVIEGETRSAALEQAPRVEIATDRVKGSISLLGGRIDDLSLKDYRETQEEDADIVTML SPVGSPGAYYALYGWAAGAGVDPSQVPGPDTEWQVIDGDILSVDAPVTLQWDNGAGLSFT RIIEIDDNYMFQITQSVANTSDAPVTVAPYGILARHGEPDDLKNFFILHEGVVAMADGEL TETNWDDIPEFPVDQREGVPAERIENVLNGWIGFTDHFWMSVLIPDPSASARLTTKYRPR ADIYQAETVLPAQTVAPGTSVSATTQLFAGAKEWETIRNYQTDGVDRFIDSIDWGWFFFL TKPIFFLLHYLNAFIGNMGWAIIGLTLIIKAILLPLAYKSYVSMAKMKELQPQMEKLKEE AGDDRQKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGPFQ DLSAPDPTSIMNLYGLLPFDGPEPGSIMALIFIGILPLLLGISMWLQQKLNPAPTDPTQQ MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFVQQYMIMRSQGYKPDVFGNIKGGFQKK TKPDSK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as certain lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Roseobacter denitrificans and its ecological significance?

Roseobacter denitrificans is a purple aerobic anoxygenic phototroph (AAP) with remarkable metabolic versatility. It represents one of the most studied AAPs and serves as a model organism for this group. The Roseobacter clade constitutes more than 10% of the microbial community in some euphotic upper ocean waters, making them potentially significant contributors to marine carbon cycling . R. denitrificans can grow photoheterotrophically in the presence of oxygen and light, as well as anaerobically in the dark using alternative electron acceptors such as nitrate or trimethylamine N-oxide . This adaptability enables R. denitrificans to thrive in competitive oligotrophic marine environments.

What is the function of YidC in bacterial cells?

YidC serves as a membrane protein insertase that is essential for bacterial inner membrane biogenesis. It significantly influences membrane protein composition and lipid organization within the bilayer . YidC functions through two primary mechanisms: (1) by interacting with the Sec translocon to aid in the proper folding of multi-pass membrane proteins, and (2) by operating independently as both an insertase and lipid scramblase to facilitate the insertion of smaller membrane proteins while contributing to bilayer organization . The protein features a membrane-exposed hydrophilic groove that facilitates the translocation of membrane proteins into the lipid bilayer, with this structural element linked to membrane bilayer thinning that reduces energy expenditure during translocation .

How is recombinant R. denitrificans YidC typically produced for research?

Recombinant R. denitrificans YidC is typically expressed in bacterial expression systems optimized for membrane protein production. The full-length protein (606 amino acids) can be expressed with various tag types depending on the experimental requirements and purification strategy . The protein is stored in Tris-based buffer with 50% glycerol to maintain stability, and repeated freeze-thaw cycles should be avoided to prevent denaturation . For working solutions, aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C or -80°C conditions .

What are the known substrates of YidC in bacterial systems?

Based on the research data, several confirmed YidC substrates include:

SubstrateDescriptionYidC Dependency
M13 procoatPhage coat protein (PC-Lep fusion)High
Pf3 coat proteinPhage coat protein (Pf3-23Lep fusion)High
F0cATP synthase subunit cHigh
SecGComponent of Sec transloconModerate
SecG I20EMutant with decreased hydrophobicityLow
YajCSingle-pass membrane proteinNone reported
YhcBSingle-pass membrane proteinNone reported

The differential effects on these substrates suggest that YidC preferentially facilitates insertion of proteins with specific transmembrane segment characteristics, with hydrophobicity appearing to be an important determinant .

How does the YidC-YibN interaction affect membrane protein insertion efficiency?

The YidC-YibN interaction represents a significant finding in membrane protein biogenesis research. YibN, a previously uncharacterized inner membrane protein, was identified as a proximal interactor of YidC through proximity-dependent biotin labeling (BioID) and confirmed through SILAC-AP/MS experiments and on-gel binding assays with purified proteins . This interaction occurs within the hydrophobic interior of the lipid bilayer, with YibN's unique transmembrane segment being critical for complex stability.

Co-expression studies demonstrate that YibN enhances the production and membrane insertion of YidC substrates. In vitro translation/insertion assays using inverted membrane vesicles (INVs) enriched for YibN showed a 1.5-1.8-fold stimulation of insertion for substrates including Pf3 coat, M13 procoat H5, and F0c compared to control INVs . This stimulation was comparable to that observed with YidC-enriched INVs for certain substrates like SecG. The effect appears to be substrate-specific and dependent on transmembrane segment hydrophobicity, as demonstrated by the reduced stimulation observed with the SecG I20E mutant .

What structural features of R. denitrificans YidC contribute to its insertase function?

R. denitrificans YidC belongs to the Oxa1 superfamily, which includes functionally related proteins like Oxa1/Alb3 and the analogous EMC3, TMCO1, GET1, and Oxa1L insertion factors . The primary structural feature that enables insertase function is a conserved membrane-exposed hydrophilic groove that facilitates the translocation of membrane proteins into the lipid bilayer .

The amino acid sequence reveals several key structural regions:

  • Multiple transmembrane segments that anchor the protein in the membrane

  • Hydrophilic regions that likely form the translocation groove

  • A C-terminal domain containing charged residues that may interact with ribosomes

The protein structure also contributes to membrane bilayer thinning, which reduces the energy barrier for translocation of membrane proteins . Additionally, the structural groove is implicated in inter-leaflet membrane lipid scramblase activity, highlighting the dual functionality of YidC in maintaining membrane integrity while assisting in protein insertion .

How does the lipid scramblase activity of YidC influence membrane composition and function?

YidC's lipid scramblase activity represents a critical secondary function beyond protein insertion. This activity allows YidC to facilitate the movement of lipids between the inner and outer leaflets of the membrane bilayer, contributing to membrane organization and homeostasis . Research indicates that YibN may interfere with YidC lipid scramblase activity, as overproduction of YibN stimulates membrane lipid production and promotes inner membrane proliferation .

The lipid scramblase activity has several implications for membrane biology:

This dual functionality—protein insertion and lipid reorganization—positions YidC as a central regulator of membrane architecture, suggesting that its activity must be tightly regulated to maintain proper membrane composition and function .

What evolutionary relationships exist between R. denitrificans YidC and insertases from other organisms?

The YidC protein from R. denitrificans is part of the evolutionarily conserved Oxa1 superfamily, which includes proteins across diverse organisms from bacteria to eukaryotes. While the search results don't provide explicit phylogenetic data for R. denitrificans YidC, we can infer evolutionary relationships based on functional conservation.

The Oxa1 superfamily includes:

  • YidC in bacteria

  • Oxa1/Alb3 in mitochondria and chloroplasts

  • EMC3, TMCO1, GET1, and Oxa1L in eukaryotes

These proteins share conserved structural features, particularly the membrane-exposed hydrophilic groove that facilitates membrane protein insertion . Recent research has identified specific interactors for related proteins, such as TMEM126A for Oxa1L , suggesting that the interaction with auxiliary proteins may be evolutionarily conserved. The identification of YibN as a YidC interactor in E. coli raises questions about whether similar interactions exist in R. denitrificans and other bacterial species.

What techniques are effective for studying YidC-substrate interactions in vitro?

Several complementary techniques have proven effective for studying YidC-substrate interactions:

  • In vitro translation/insertion assays: Using inverted membrane vesicles (INVs) enriched for YidC or its interactors to assess insertion efficiency of radiolabeled substrates . This approach allows quantitative comparison of insertion rates between different membrane preparations.

  • Proteinase K protection assays: Following membrane insertion, proteinase K digestion reveals membrane-protected fragments that can be detected and quantified to assess insertion efficiency and topology .

  • Co-expression studies: Monitoring the biogenesis of YidC substrates when co-expressed with potential interactors can reveal functional relationships . This approach typically involves expression induction followed by sampling at timed intervals and western blot analysis.

  • Proximity-dependent biotin labeling (BioID): This technique identifies proteins in close proximity to YidC within the cellular environment, enabling discovery of novel interactors .

  • Affinity purification-mass spectrometry (AP-MS): Combined with stable isotope labeling by amino acids in cell culture (SILAC), this approach enables quantitative assessment of protein-protein interactions in native membranes .

  • On-gel binding assays with purified proteins: This technique validates direct interactions between purified proteins in detergent solutions .

How can the effect of transmembrane segment hydrophobicity on YidC-mediated insertion be quantified?

The effect of transmembrane segment hydrophobicity on YidC-mediated insertion can be quantified through systematic approaches:

  • Mutational analysis: Creating variants with altered hydrophobicity in transmembrane segments, such as the SecG I20E mutation, allows direct comparison of insertion efficiency . The reduced effect of YibN on SecG I20E insertion compared to wild-type SecG demonstrates how this approach can reveal hydrophobicity dependence.

  • In vitro translation/insertion assays: Quantifying insertion efficiency using INVs enriched for YidC or its interactors provides a direct measure of hydrophobicity effects .

  • Membrane-protected fragment analysis: Following proteinase K digestion, quantifying the relative abundance of membrane-protected fragments derived from different transmembrane segments can reveal segment-specific insertion dependencies .

  • Hydrophobicity scales and computational prediction: Calculating hydrophobicity scores for transmembrane segments using established scales (Kyte-Doolittle, Goldman-Engelman-Steitz, etc.) can predict YidC dependency.

  • Fluorescence-based insertion assays: Monitoring the insertion of fluorescently labeled transmembrane peptides with varying hydrophobicity into model membranes containing purified YidC.

What analytical methods best characterize the structural properties of recombinant YidC?

Several analytical methods are particularly valuable for characterizing the structural properties of recombinant YidC:

  • X-ray crystallography or cryo-electron microscopy: These techniques provide atomic-level structural information, revealing the architecture of the hydrophilic groove and transmembrane segments.

  • Circular dichroism (CD) spectroscopy: Useful for assessing secondary structure content and conformational changes under different conditions.

  • Cross-linking coupled with mass spectrometry: Identifies proximity relationships between amino acid residues, helping map interaction interfaces with substrates or partner proteins like YibN .

  • Hydrogen-deuterium exchange mass spectrometry: Reveals solvent-accessible regions and conformational dynamics.

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR): Provides information about local environment and distances between labeled sites.

  • Fluorescence resonance energy transfer (FRET): Measures distances between fluorophore-labeled domains, useful for monitoring conformational changes during substrate interaction.

  • Nuclear magnetic resonance (NMR) spectroscopy: While challenging for large membrane proteins, selective labeling approaches can provide valuable structural insights for specific domains.

How does R. denitrificans metabolism influence membrane protein composition?

R. denitrificans exhibits remarkable metabolic versatility that likely influences its membrane protein composition. As an aerobic anoxygenic phototroph, it can grow photoheterotrophically in the presence of oxygen and light, as well as anaerobically using alternative electron acceptors . This metabolic flexibility demands a dynamic membrane proteome capable of accommodating various energy generation pathways.

The organism possesses several metabolic capabilities that impact membrane composition:

  • Phototrophy: The photosynthetic apparatus in the membrane requires proper insertion of light-harvesting complexes and electron transport components .

  • Denitrification: The ability to use nitrate as an electron acceptor involves membrane-bound nitrate reductases and associated electron transport proteins .

  • Sulfur metabolism: The presence of sulfur oxidation pathways (encoded by the soxWXYZABCDEF cluster) and dimethyl sulfoxide reduction systems suggests membrane-associated sulfur metabolism machinery .

  • Carbon monoxide oxidation: Genes for CO oxidation (coxG and coxSML) indicate the presence of membrane-associated CO dehydrogenase complexes .

The absence of RuBisCO and the Calvin cycle in R. denitrificans suggests reliance on alternative carbon fixation pathways, potentially involving membrane-associated transport systems for organic carbon acquisition . The role of YidC in inserting components of these diverse metabolic systems would be a fascinating area for future research.

What is known about the regulatory mechanisms controlling YidC expression and activity?

While the search results don't provide detailed information about YidC regulation specifically in R. denitrificans, they do mention regulatory aspects of photosynthesis genes that may be relevant. The genome of R. denitrificans contains some genes for redox-dependent regulation of photosynthetic machinery, although many light sensors and transcriptional regulatory motifs found in purple photosynthetic bacteria are absent .

In general, potential regulatory mechanisms for YidC may include:

  • Transcriptional regulation: Expression levels may be controlled by transcription factors responding to membrane stress or protein folding demands.

  • Post-translational modifications: Phosphorylation or other modifications could modulate YidC activity in response to cellular conditions.

  • Protein-protein interactions: The interaction with YibN represents a potential regulatory mechanism, as YibN enhances YidC-mediated insertion of specific substrates .

  • Membrane lipid composition: As YidC functions as both insertase and lipid scramblase, the local lipid environment likely influences its activity.

The discovery that YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation suggests a regulatory relationship between YidC activity and membrane biogenesis . This represents an exciting area for future research in R. denitrificans and other bacterial systems.

How might comparative studies between different bacterial YidC homologs inform therapeutic development?

Comparative studies between YidC homologs from different bacterial species, including R. denitrificans, could significantly inform therapeutic development strategies. As an essential component for membrane protein biogenesis, YidC represents a potential antibiotic target. Key considerations include:

  • Structural conservation and divergence: Identifying regions of YidC that are highly conserved across pathogens but divergent from human homologs could guide the development of selective inhibitors.

  • Species-specific interactions: The discovery of YibN as a YidC interactor raises questions about whether similar interactions exist across species . Species-specific interactors could provide targets for narrow-spectrum antibiotics.

  • Substrate specificity: Understanding differences in substrate preference between YidC homologs could reveal critical dependencies in specific pathogens.

  • Functional redundancy: Assessing whether alternative insertion pathways exist in different species would help predict potential resistance mechanisms.

  • Evolutionary adaptations: Comparing YidC from environmentally diverse bacteria like R. denitrificans with those from human pathogens might reveal adaptations that could be exploited therapeutically.

The unique metabolic versatility of R. denitrificans suggests its YidC may handle a diverse substrate portfolio, potentially providing insights into how YidC could be targeted in metabolically flexible pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.