Recombinant Roseobacter denitrificans Reaction center protein L chain (pufL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you require a specific format, please specify your needs during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, kindly consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
pufL; RD1_0104; Reaction center protein L chain; Photosynthetic reaction center L subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)
Target Names
pufL
Target Protein Sequence
MALLSFERKYRVRGGTLVGGDLFDFWVGPFYVGFFGVTTAFFALLGTILIFWGASQQGTF NPWLINIAPPDLSYGLGLAPLLEGGLWQIITICATGAFISWALREVEICRKLGMGYHVPF GFAAAIIAYMTLVIFRPLLMGAWGHGFPYGIFSHLDWVSNVGYAYLHFHYNPAHMLAVTL FFTTTLALALHGGLILSACNPEKGEEAKTPDHEDTFFRDFIGYSVGTLGIHRLGYLLAIN AGLWSAICIIISGPVWTAGWPEWWNWWLDMPIWGEPIAVIGGM
Uniprot No.

Target Background

Function
The reaction center is a membrane-bound complex that mediates the initial photochemical event in the electron transfer process of photosynthesis.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular chromatophore membrane; Multi-pass membrane protein.

Q&A

What is the puf operon in Roseobacter denitrificans and how is it organized?

The puf operon in Roseobacter denitrificans encodes the structural proteins of the photosynthetic reaction center (RC) and light-harvesting complex I (LHI). Specifically, the operon contains genes for the reaction center polypeptides (PufL and PufM), the light-harvesting complex I polypeptides (PufA and PufB), and the tetraheme cytochrome (PufC) . The organization of this operon is unique but shares similarities with other purple photosynthetic bacteria.

The gene arrangement in R. denitrificans shows characteristics that resemble both Rhodobacter species and Rubrivivax gelatinosus. The crtEF-bchCXYZ-puf cluster organization is similar to that found in Rhodobacter, while other aspects of the photosynthetic gene cluster (PGC) organization, such as idi-bchFNBHLM-lhaA-puhA, match the pattern seen in R. gelatinosus . This hybrid organization provides interesting insights into the evolutionary relationships between these photosynthetic bacteria.

How does the pufL protein function within the reaction center complex?

The PufL protein serves as one of the core subunits of the photosynthetic reaction center in R. denitrificans. Together with PufM, it forms the heterodimeric core of the reaction center that binds the primary electron donors and acceptors involved in light-induced electron transfer. The L and M subunits provide the scaffold for precisely positioning the cofactors required for photochemical reactions.

In functional terms, the reaction center captures light energy and converts it to chemical energy through a series of electron transfer steps. While the composition and sequence of reactions in the reaction centers of R. denitrificans are very similar to those in Rhodobacter capsulatus, there appear to be differences in the midpoint redox potentials of the carriers in the photosynthetic apparatus and in the capacity to adapt to different redox conditions . These differences reflect the adaptation of R. denitrificans to its aerobic lifestyle, unlike the facultative anaerobic lifestyle of Rhodobacter species.

What are the key structural features that distinguish R. denitrificans pufL from homologs in other photosynthetic bacteria?

While the search results don't provide specific structural details about the PufL protein in R. denitrificans, we can infer some distinguishing features based on the information available. The reaction centers of purple bacteria typically contain L and M subunits with five transmembrane helices each, forming a pseudo-symmetric structure.

Given that R. denitrificans is an obligately aerobic phototroph, unlike the facultatively anaerobic Rhodobacter species, its PufL protein likely contains modifications that optimize function in aerobic environments. These adaptations would potentially include alterations in amino acid residues near the cofactor binding sites to accommodate different redox potentials or to provide protection against oxidative damage.

The fact that the heterologous expression of the R. denitrificans puf operon in R. capsulatus was successfully achieved suggests structural compatibility between the systems, despite their different ecological niches .

What are the optimal expression systems for producing recombinant R. denitrificans pufL protein?

Based on the available research, several expression systems have been used for recombinant production of photosynthetic proteins from R. denitrificans:

  • Heterologous expression in Rhodobacter capsulatus: The search results indicate that the entire puf operon from R. denitrificans has been successfully expressed in a photosynthetically inactive R. capsulatus mutant (strain CK11) . This approach allows the assembly of a functional reaction center complex, making it valuable for studying the properties of the intact photosynthetic machinery.

  • Expression in Escherichia coli: Although not specifically mentioned for pufL in the search results, E. coli expression systems are commonly used for recombinant production of bacterial proteins. For example, the RdDddP protein from R. denitrificans was successfully expressed in E. coli BL21(DE3) cells using the pET28 vector system and auto-induction medium (ZYP-5052) .

For optimal expression of membrane proteins like PufL, considerations should include:

  • Using expression hosts with the machinery for proper membrane protein insertion

  • Including native or compatible promoter systems

  • Optimizing growth conditions to balance protein expression with proper folding and assembly

The successful expression of the R. denitrificans puf operon in R. capsulatus suggests that related photosynthetic bacteria provide good chassis for functional expression.

How can I design a plasmid construct for effective expression of recombinant pufL?

Based on the methodology described in the search results, an effective strategy for plasmid construction would include:

  • Selection of appropriate vector backbone: For expression in Rhodobacter species, mobilizable broad-host-range plasmids like pTJS133 derivatives have been successfully used .

  • Promoter selection: Placing the R. denitrificans puf genes under the control of a compatible promoter, such as the R. capsulatus puf promoter (PRc) when expressing in R. capsulatus hosts .

  • Orientation considerations: When cloning multiple puf operons, orientating them in opposite directions can "avoid deletion events by homologous recombination" .

  • Resistance markers: Including appropriate antibiotic resistance genes for selection (e.g., kanamycin resistance).

A specific example from the literature involves inserting an 8.9-kb SalI fragment (Klenow treated) containing the R. denitrificans puf genes into the XhoI site (also Klenow treated) of a suitable vector (pTJS133::2fd in the referenced work) .

What are the key parameters for optimizing expression conditions?

For optimal expression of recombinant photosynthetic proteins like pufL, several parameters should be carefully controlled:

What purification strategy yields the highest purity and activity for recombinant pufL protein?

While the search results don't provide specific purification protocols for isolated pufL protein, we can infer effective strategies based on related protein purification methods:

For membrane proteins like PufL, a multi-step purification approach is typically required:

  • Membrane isolation: After cell lysis (chemical lysis with lysozyme followed by detergent treatment has been used for R. denitrificans proteins ), differential centrifugation can separate membrane fractions.

  • Detergent solubilization: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are commonly used to solubilize membrane proteins while maintaining their native structure.

  • Affinity chromatography: If the recombinant protein includes an affinity tag (e.g., His-tag), immobilized metal affinity chromatography (IMAC) can be used.

  • Ion exchange and size exclusion chromatography: These techniques can further purify the protein based on charge and size properties.

For functional studies of the entire reaction center complex, rather than isolated pufL, purification of chromatophore membranes or membrane fractions enriched in reaction centers might be more appropriate.

What spectroscopic methods are most informative for characterizing recombinant pufL?

For comprehensive characterization of recombinant pufL and assembled reaction centers, several spectroscopic techniques are particularly valuable:

  • UV-Visible absorption spectroscopy: Reaction centers have characteristic absorption bands that reflect the presence and environment of bacteriochlorophyll and other cofactors. This technique can confirm proper folding and cofactor incorporation.

  • Circular dichroism (CD) spectroscopy: Provides information about the secondary structure of proteins and can help assess proper folding of recombinant pufL.

  • Fluorescence spectroscopy: Can probe the energy transfer processes in assembled reaction centers.

  • Electron paramagnetic resonance (EPR) spectroscopy: Valuable for studying the electron transfer cofactors and their redox states.

  • Fourier-transform infrared spectroscopy (FTIR): Can provide detailed information about protein structure and cofactor interactions.

  • Resonance Raman spectroscopy: Particularly useful for examining the interactions between proteins and their chromophores.

When assessing functional aspects, measuring light-induced electron transfer activities using spectroscopic or electrochemical methods provides crucial information about the biological activity of the recombinant protein.

How can I assess the proper assembly and functionality of recombinant pufL in membrane complexes?

Assessing proper assembly and functionality of recombinant pufL within the reaction center complex requires multiple analytical approaches:

  • Spectroscopic analysis: The characteristic absorption spectrum of properly assembled reaction centers provides a quick assessment of functional assembly. Reaction centers typically show distinctive peaks in the near-infrared region due to bacteriochlorophyll absorption.

  • SDS-PAGE and immunoblotting: These techniques can verify the presence of PufL protein of the expected molecular weight and its association with other reaction center components.

  • Native-PAGE or Blue Native-PAGE: These approaches can help assess whether PufL is incorporated into higher-order complexes of the expected size.

  • Functional assays: Measuring light-induced electron transfer activities using artificial electron donors and acceptors can confirm functionality. This can be done using spectroscopic methods to monitor changes in absorbance upon illumination.

  • Fluorescence quenching experiments: These can provide information about energy transfer within the assembled complexes.

  • Structural analysis: Techniques like cryo-electron microscopy or X-ray crystallography (if crystals can be obtained) provide the most detailed information about proper assembly.

For heterologously expressed systems, comparing these parameters with those of native R. denitrificans reaction centers provides a benchmark for successful recombinant expression and assembly.

How can recombinant pufL be used to study photosynthetic electron transfer mechanisms in aerobic phototrophs?

Recombinant pufL proteins offer powerful tools for investigating electron transfer mechanisms in aerobic phototrophs like R. denitrificans:

  • Site-directed mutagenesis: By introducing specific mutations into the pufL gene, researchers can examine how particular amino acid residues contribute to cofactor binding, electron transfer rates, and redox potentials. This approach can help elucidate the molecular adaptations that allow R. denitrificans to perform photosynthesis under aerobic conditions.

  • Chimeric proteins: Creating chimeric proteins that combine domains from pufL of different species (e.g., R. denitrificans and R. capsulatus) can help identify regions responsible for specific functional properties, such as oxygen tolerance or different redox potentials.

  • Heterologous expression systems: As demonstrated in the research where R. denitrificans puf genes were expressed in R. capsulatus , these systems allow comparison of how the same protein functions in different cellular environments.

  • Time-resolved spectroscopy: When combined with recombinant protein technology, these techniques can probe the kinetics of electron transfer events and how they differ between aerobic and anaerobic phototrophs.

The fact that the reaction centers and electron transport systems of R. denitrificans and Rhodobacter capsulatus are very similar in composition and sequence of reactions, despite their different oxygen requirements, makes comparative studies particularly valuable for understanding adaptations to different ecological niches .

What insights can comparative studies between R. denitrificans pufL and homologs from anaerobic phototrophs provide?

Comparative studies between the pufL protein from aerobic R. denitrificans and its homologs from anaerobic phototrophs can provide significant insights:

  • Evolutionary adaptations: By analyzing sequence and structural differences, researchers can identify the evolutionary adaptations that allow R. denitrificans to perform photosynthesis in the presence of oxygen, unlike anaerobic purple bacteria.

  • Oxygen tolerance mechanisms: Comparative studies can reveal specific amino acid substitutions or structural features that confer resistance to oxidative damage in the aerobic phototroph's reaction center.

  • Redox potential differences: The search results suggest that R. denitrificans and Rhodobacter species "differ in the midpoint redox potentials of the redox carrier in the photosynthetic apparatuses and in the capacity to adapt to different redox conditions" . Comparative studies of pufL can help elucidate the molecular basis of these differences.

  • Regulatory mechanisms: Different phototrophs show varying responses to environmental factors like light and oxygen. For instance, "the expression of the puf operon is more strongly inhibited by light than in R. sphaeroides" . Comparing the regulation of pufL expression across species can provide insights into these adaptive responses.

  • Horizontal gene transfer analysis: The search results indicate interesting synteny relationships between the photosynthetic gene clusters of R. denitrificans, Rhodopseudomonas, Rubrivivax, and Rhodobacter species . This suggests potential lateral gene transfer events that can be further explored through comparative genomic and protein studies.

How can structural modifications of recombinant pufL be used to engineer novel photosynthetic properties?

Structural engineering of recombinant pufL offers exciting possibilities for creating novel photosynthetic properties:

  • Altering spectral properties: By modifying amino acids that interact with bacteriochlorophyll molecules and other cofactors, researchers can potentially shift the absorption spectrum of the reaction center, expanding the range of light wavelengths that can be utilized for photosynthesis.

  • Enhancing electron transfer efficiency: Strategic mutations in the electron transfer pathway could improve the efficiency of charge separation and reduce recombination rates, potentially leading to more efficient light energy conversion.

  • Increasing oxygen tolerance: For applications in synthetic biology, engineering increased oxygen tolerance into reaction centers based on insights from R. denitrificans could enable photosynthetic activity in diverse environments.

  • Creating hybrid systems: Constructing chimeric reaction centers that combine the oxygen tolerance of R. denitrificans with desirable properties from other species could lead to novel bioenergetic systems.

  • Cofactor modifications: Engineering the protein to accommodate alternative cofactors could create reaction centers with novel properties for biotechnological applications.

  • Stability engineering: Modifications that enhance the thermal or chemical stability of the reaction center could extend the range of conditions under which these proteins can function.

These approaches require detailed understanding of structure-function relationships in reaction center proteins, which can be gained through the combination of structural studies, spectroscopic analyses, and functional assays of engineered variants.

What are the common issues in heterologous expression of pufL and how can they be resolved?

Researchers frequently encounter several challenges when expressing recombinant pufL:

  • Poor expression levels:

    • Problem: Membrane proteins like PufL often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the host organism, use specialized expression strains, reduce expression temperature (e.g., 20°C as used for RdDddP ), and try different promoter strengths.

  • Improper membrane insertion:

    • Problem: Recombinant PufL may not insert correctly into host membranes.

    • Solution: Use hosts with similar membrane composition to R. denitrificans, such as other alphaproteobacteria. The successful expression in R. capsulatus demonstrates the feasibility of this approach .

  • Protein aggregation:

    • Problem: Overexpressed membrane proteins often aggregate.

    • Solution: Reduce expression rate, optimize detergent for solubilization, and consider fusion tags that enhance solubility.

  • Lack of cofactor incorporation:

    • Problem: Proper assembly requires correct incorporation of bacteriochlorophyll and other cofactors.

    • Solution: Ensure the host can synthesize necessary cofactors or supplement them exogenously. Using photosynthetic bacteria as hosts (as shown with R. capsulatus ) can address this issue.

  • Genetic instability:

    • Problem: Recombination between homologous sequences can lead to plasmid instability.

    • Solution: Orient repeated sequences in opposite directions, as was done with the puf operons in plasmids pCKF24 and pCKF27 to "avoid deletion events by homologous recombination" .

How can I troubleshoot issues with cofactor binding and reaction center assembly?

When facing problems with cofactor binding and proper assembly of reaction centers containing recombinant pufL:

  • Spectroscopic analysis for diagnostic purposes:

    • Problem: Difficulty determining if cofactors are properly incorporated.

    • Solution: Use absorption spectroscopy to check for characteristic peaks that indicate proper cofactor binding. Compare with spectra from native R. denitrificans reaction centers.

  • Incomplete reaction center assembly:

    • Problem: PufL expresses but doesn't assemble with other components.

    • Solution: Ensure co-expression of all necessary components (PufM, PufA, PufB, PufC). The search results indicate successful heterologous expression of the complete puf operon .

  • Improper redox conditions:

    • Problem: Assembly may require specific redox conditions.

    • Solution: R. denitrificans and Rhodobacter species "differ in the midpoint redox potentials of the redox carrier in the photosynthetic apparatuses and in the capacity to adapt to different redox conditions" . Optimize cellular redox conditions during expression by adjusting aeration or adding redox-active compounds.

  • Cofactor availability:

    • Problem: Limited availability of bacteriochlorophyll and other cofactors.

    • Solution: Use growth conditions that promote cofactor synthesis or consider supplementation strategies.

  • Post-translational modifications:

    • Problem: Missing necessary modifications for proper assembly.

    • Solution: If specific post-translational modifications are required, ensure the expression host can perform these modifications.

  • Interaction with auxiliary proteins:

    • Problem: Assembly may require chaperones or other helper proteins.

    • Solution: Co-express known assembly factors or consider using cell-free systems supplemented with necessary factors.

What strategies can resolve issues with functional activity of purified recombinant pufL complexes?

When purified recombinant pufL-containing complexes show suboptimal functional activity:

  • Detergent interference:

    • Problem: Detergents used for purification may disrupt native protein-protein or protein-lipid interactions.

    • Solution: Screen multiple detergents with varying properties; consider reconstitution into liposomes or nanodiscs to provide a more native-like membrane environment.

  • Loss of cofactors during purification:

    • Problem: Essential cofactors may be lost during purification steps.

    • Solution: Use gentler purification conditions, minimize exposure to light and oxygen, and consider adding stabilizing agents specific to the cofactors.

  • Redox state management:

    • Problem: Improper redox states of cofactors.

    • Solution: Carefully control redox conditions during purification and storage; consider adding appropriate redox mediators during functional assays.

  • Subunit stoichiometry issues:

    • Problem: Incorrect stoichiometry of reaction center components.

    • Solution: Analyze purified complexes by analytical techniques like SEC-MALS (size exclusion chromatography with multi-angle light scattering) to verify correct assembly and adjust purification strategy accordingly.

  • Lipid requirements:

    • Problem: Specific lipids may be required for optimal activity.

    • Solution: Identify lipid requirements through targeted lipidomic analysis of native membranes and supplement purified complexes with these lipids.

  • Buffer optimization:

    • Problem: Suboptimal buffer conditions affecting activity.

    • Solution: Systematically screen different buffer components, pH values, and ionic strengths to identify conditions that maximize functional activity.

  • Oxidative damage:

    • Problem: Being from an aerobic phototroph, R. denitrificans proteins may still be susceptible to specific types of oxidative damage.

    • Solution: Include appropriate antioxidants in buffers and minimize exposure to excess oxygen and light during purification and storage.

How does the genetic organization of the puf operon in R. denitrificans compare with other photosynthetic bacteria?

The genetic organization of the puf operon in R. denitrificans shows interesting evolutionary relationships with other photosynthetic bacteria:

  • Hybrid organization pattern:
    The photosynthetic gene cluster (PGC) organization in R. denitrificans shows characteristics of both Rhodobacter species and Rubrivivax gelatinosus. Specifically:

    • The gene arrangement of idi-bchFNBHLM-lhaA-puhA in R. denitrificans matches that seen in R. gelatinosus

    • The crtEF-bchCXYZ-puf cluster resembles Rhodobacter rather than Rubrivivax organization

  • Unique features:

    • The organization is described as "unique" even though it shares similarities with other species

    • The segregation of bchE and bchJ to distant parts of the chromosome is a feature shared with R. gelatinosus

  • Evolutionary implications:

    • The synteny between the Roseobacter cluster and the Rhodopseudomonas/Rubrivivax PGC suggests potential lateral gene transfer events in the evolution of these photosynthetic systems

    • Previous work proposed a lateral transfer of the PGC from an R. palustris ancestor into R. gelatinosus, and the similarities with R. denitrificans add complexity to this evolutionary history

This comparative genomic information suggests that the puf operon and the broader photosynthetic gene cluster in R. denitrificans represent an interesting evolutionary mosaic, potentially resulting from horizontal gene transfer events between different lineages of photosynthetic bacteria.

What functional differences exist between the reaction centers of aerobic phototrophs like R. denitrificans and anaerobic purple bacteria?

Several important functional differences distinguish the reaction centers of aerobic phototrophs like R. denitrificans from those of anaerobic purple bacteria:

  • Oxygen tolerance and response:

    • R. denitrificans can perform photosynthesis in the presence of oxygen, unlike anaerobic purple bacteria

    • The level of puf transcripts in R. denitrificans is independent of oxygen partial pressure, contrasting with the oxygen-dependent regulation seen in species like R. sphaeroides

  • Light regulation:

    • The expression of the puf operon in R. denitrificans is "more strongly inhibited by light than in R. sphaeroides" , indicating differences in regulatory mechanisms

  • Redox properties:

    • R. denitrificans and Rhodobacter species are thought to "differ in the midpoint redox potentials of the redox carrier in the photosynthetic apparatuses and in the capacity to adapt to different redox conditions"

    • These differences likely reflect adaptations to their respective ecological niches

  • Metabolic context:

    • While the reaction center components themselves may be similar, the metabolic context differs significantly

    • R. denitrificans lacks the Calvin cycle for carbon fixation (missing RuBisCO and phosphoribulokinase) , suggesting that its photosynthetic apparatus serves a primarily energy-generating rather than carbon-fixing role

  • Antenna systems:

    • While not explicitly stated in the search results, aerobic phototrophs typically have differences in their light-harvesting antenna systems compared to anaerobic purple bacteria, optimized for their specific light environments

Despite these differences, the search results indicate that "the composition and sequence of reactions in the RCs and electron transport systems of R. denitrificans and Rhodobacter capsulatus are very similar" , suggesting that the core electron transfer mechanism is conserved despite adaptation to different oxygen regimes.

How can insights from R. denitrificans pufL research inform our understanding of photosynthetic evolution and adaptation?

Research on R. denitrificans pufL provides several important insights into photosynthetic evolution and adaptation:

  • Evolution of aerobic photosynthesis:

    • R. denitrificans represents an important evolutionary transition, performing photosynthesis aerobically but not producing oxygen

    • Understanding the modifications in its reaction center proteins, including PufL, can reveal how anaerobic photosynthetic systems adapted to function in aerobic environments

  • Modular evolution of photosynthetic gene clusters:

    • The hybrid nature of the photosynthetic gene cluster in R. denitrificans, sharing features with both Rhodobacter and Rubrivivax systems , supports the concept of modular evolution through horizontal gene transfer

    • This suggests that photosynthetic systems may evolve through the acquisition and recombination of functional modules rather than solely through gradual mutation

  • Ecological adaptation:

    • Purple aerobic anoxygenic phototrophs like R. denitrificans "compose more than 10% of the microbial community in some euphotic upper ocean waters and are potentially major contributors to the fixation of the greenhouse gas CO2"

    • Understanding their photosynthetic adaptations provides insights into how microorganisms exploit light energy in diverse ecological niches

  • Regulatory evolution:

    • Differences in how light and oxygen regulate gene expression between R. denitrificans and anaerobic phototrophs illuminate the evolution of regulatory networks during adaptation to new environments

  • Metabolic integration:

    • R. denitrificans lacks the Calvin cycle but has alternative CO2 fixation pathways , illustrating how photosynthetic energy harvesting can be integrated with different metabolic strategies

  • Structural conservation amid functional divergence:

    • The successful heterologous expression of R. denitrificans puf genes in R. capsulatus demonstrates structural conservation despite adaptation to different ecological niches

    • This suggests that core photosynthetic machinery is highly conserved, with adaptations to different environments potentially involving relatively small changes to key residues or regulatory systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.