Recombinant Rotavirus B Non-structural protein 1, peptide 1

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please indicate your desired format when placing your order, and we will ensure it is fulfilled.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Non-structural protein 1, peptide 1; NSP1 peptide 1; NSP1-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Rotavirus B (isolate RVB/Human/China/ADRV/1982) (RV-B) (Rotavirus B (isolate adult diarrhea rotavirus))
Target Protein Sequence
MGNRQSSAQLNSHLTHINSQNSNLFISDSKTAVFHTQHILLAAGVGIIATLLVLLLCSCV LNCYLCRRLKRTNGVSSLLERNLRQNGSSAKIYVKPVMQSSTIIEEA
Uniprot No.

Target Background

Protein Families
Rotavirus B NSP1-1 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is RVB NSP1-1 and how does it differ from RVA NSP1?

RVB NSP1-1 is a small protein approximately 100 amino acids in length encoded by the first open reading frame (ORF) of the NSP1 gene segment in Rotavirus species B. Unlike Rotavirus species A (RVA), which encodes a single NSP1 protein that antagonizes interferon signaling, RVB encodes two distinct proteins from its NSP1 gene segment: NSP1-1 and NSP1-2. RVB NSP1-1 functions as a fusion-associated small transmembrane (FAST) protein that mediates syncytium formation in cultured human cells . This represents a major genetic and functional difference between species A and B rotaviruses.

What are the key structural domains of RVB NSP1-1?

RVB NSP1-1 contains several key structural domains identified through sequence alignment and structural prediction:

  • N-terminal domain: Contains a myristoylation site at amino acids 2-7 that is critical for fusion activity

  • Transmembrane (TM) domain: For RVB Bang117 NSP1-1, spans approximately amino acids 39-61

  • Cytoplasmic tail: Contains a polybasic region shortly after the TM domain

  • Hydrophobic regions: Variable distribution, with some RVB strains containing hydrophobic regions in the N-terminal domain or two short hydrophobic regions in the C-terminal domain

The protein is oriented with its N-terminus extracellular and C-terminus cytoplasmic, consistent with other viral FAST proteins .

What expression systems are optimal for producing functional RVB NSP1-1?

For functional studies of RVB NSP1-1, researchers should consider:

  • Mammalian expression systems: pCAGGS vector has been successfully used for NSP1-1 expression

  • Cell line selection: Human embryonic kidney 293T cells are permissive for human RVB NSP1-1-mediated fusion

  • Protein detection: C-terminal epitope tagging (e.g., FLAG tag) is recommended as N-terminal tags disrupt fusion function

  • Expression timing: 24 hours post-transfection is typically sufficient to observe syncytium formation

When expressing tagged versions, it's critical to note that N-terminally tagged NSP1-1 (FLAG-NSP1-1) fails to mediate cell fusion, while C-terminally tagged NSP1-1 (NSP1-1-FLAG) maintains fusion activity, indicating the importance of an intact N-terminus .

What assays can detect and quantify RVB NSP1-1-mediated fusion?

Researchers can employ several approaches to assess NSP1-1 fusion activity:

  • Differential interference contrast microscopy: Visualize syncytium formation, which appears as smooth oval-shaped regions lacking defined cell edges in the monolayer

  • Comparison with known FAST proteins: Include positive controls such as Nelson Bay orthoreovirus (NBV) p10 FAST protein

  • Morphological assessment: Monitor changes from individually distinct cells to fused syncytia

  • Cell-type specificity testing: Compare fusion in different cell lines (e.g., human vs. hamster cells) to assess species specificity

When designing fusion assays, researchers should include appropriate negative controls (vector-transfected cells) and positive controls (known FAST proteins) to properly interpret results.

How does NSP1-1 contribute to rotavirus replication and spread?

NSP1-1 enhances rotavirus replication through several potential mechanisms:

  • Cell-cell fusion may facilitate viral spread by allowing direct transfer of viral components between cells

  • Syncytium formation may create an environment favorable for viral replication

  • NSP1-1 enhances species A rotavirus replication in both single-cycle infection studies and during multicycle time courses

  • In the presence of fetal bovine serum (which typically inhibits rotavirus spread), NSP1-1 can enhance viral replication

The ability of RVB NSP1-1 to enhance RVA replication suggests conservation of fusion-mediated enhancement across rotavirus species, despite their genetic differences.

What is the evidence for NSP1-1's role in viral tropism?

NSP1-1 demonstrates species-specific fusion activity that may influence viral tropism:

  • NSP1-1 from human RVB mediates fusion of human cells but not hamster cells

  • This species-specific activity correlates with the epidemiological patterns of RVB infection

  • The fusion specificity suggests NSP1-1 may serve as a species tropism determinant

  • Species-specific fusion could contribute to the host range restriction observed in rotavirus infections

This species specificity provides insight into why rotavirus strains often show host species preferences and limited cross-species transmission.

How does RVB NSP1-1 compare to other FAST proteins in the Reoviridae family?

RVB NSP1-1 shares structural and functional similarities with other FAST proteins:

FeatureRVB NSP1-1Other FAST Proteins (BroV, RRV, BRV)
Size~100 amino acidsTypically 98-140 amino acids
N-myristoylationPresentPresent in many FAST proteins
Membrane topologyN-terminus extracellularSimilar orientation
Transmembrane domainSingleSingle
Polybasic regionPresent post-TMCommon feature
Length relative to othersShorterOften longer C-terminal domains

The conservation of these structural features across different viruses suggests convergent evolution toward a common fusion mechanism .

How does NSP1-1 differ from RVA NSP1 in function?

The functional differences between NSP1-1 and RVA NSP1 reflect their distinct roles:

  • RVA NSP1: Functions primarily as an interferon antagonist by targeting components of the host interferon signaling pathway

  • RVB NSP1-1: Acts as a FAST protein mediating cell-cell fusion

  • RVA NSP1: Not essential for viral replication in cell culture, as demonstrated with NSP1-null recombinant viruses

  • RVB NSP1-1: Appears to be critical for efficient viral spread and replication

These different functions highlight the evolutionary diversity within the rotavirus genus despite conservation of most other viral proteins.

How can NSP1-1 be incorporated into rotavirus reverse genetics platforms?

Researchers can utilize NSP1-1 in reverse genetics systems to:

  • Enhance rescue efficiency: Similar to how NBV p10 FAST protein enhances rotavirus reverse genetics systems

  • Promote spread of recombinant viruses: Particularly in the presence of serum, which typically inhibits rotavirus spread

  • Study species-specific viral replication: By incorporating NSP1-1 from different species into chimeric viruses

  • Investigate fusion requirements: Through systematic mutagenesis of NSP1-1 in the context of viral infection

The reverse genetics system for simian rotavirus strain SA11 has benefited from including FAST proteins, suggesting NSP1-1 could serve a similar function for RVB reverse genetics development.

What challenges exist in creating NSP1-1 mutants for functional studies?

When designing NSP1-1 mutants, researchers should consider:

  • N-terminal integrity: Modifications to the N-terminus (including tagging) disrupt fusion function

  • Potential for reversion: Evidence from rotavirus studies shows strong selective pressure for functional NSP1

  • Transmembrane domain requirements: Mutations must preserve proper membrane topology

  • Species-specific differences: Mutations may have different effects depending on the viral strain and host cells

How might NSP1-1 contribute to the development of attenuated rotavirus vaccines?

NSP1-1 presents several promising avenues for vaccine development:

  • Targeted attenuation: Modification of NSP1-1 could create replication-competent but attenuated rotavirus strains

  • Species-specific adaptation: Engineering NSP1-1 could help adapt rotaviruses to grow efficiently in vaccine production cell lines

  • Fusion enhancement: Co-expression of NSP1-1 might improve yield of attenuated vaccine strains in production systems

  • Genetic stability: Understanding reversion patterns of NSP1-1 mutations could help design more stable attenuated vaccines

Research with NSP1-deficient rotaviruses has demonstrated their potential as attenuated vaccine candidates, suggesting similar approaches could work for NSP1-1 modification .

What methodologies can elucidate the mechanism of NSP1-1-mediated membrane fusion?

To investigate the fusion mechanism, researchers should consider:

  • Mutagenesis studies: Systematic modification of the N-myristoylation site, transmembrane domain, and polybasic region

  • Biophysical approaches: Fluorescence resonance energy transfer (FRET) to monitor lipid mixing during fusion

  • Structural biology techniques: Determine the three-dimensional structure of NSP1-1 in membrane-mimetic environments

  • Lipid composition analysis: Assess the role of specific membrane lipids in NSP1-1-mediated fusion

  • Cross-linking studies: Identify potential NSP1-1 multimerization during the fusion process

Understanding the fusion mechanism could provide insights for designing fusion inhibitors or enhancers for therapeutic applications.

How might NSP1-1-mediated fusion affect host immune responses?

NSP1-1 could modulate host immunity through several mechanisms:

  • Immune evasion: Cell-cell fusion may allow virus to spread while avoiding exposure to neutralizing antibodies

  • Altered antigen presentation: Syncytium formation could impact MHC presentation of viral antigens

  • Modulation of innate responses: Fusion may disrupt cellular architecture required for some innate immune signaling pathways

  • Cytopathic effects: Extensive syncytium formation could trigger inflammatory responses in infected tissues

These potential immunomodulatory effects represent an important area for future research, particularly in understanding RVB pathogenesis.

Does NSP1-1 function independently of or synergistically with interferon antagonism?

While RVA NSP1 directly antagonizes interferon responses, the relationship between RVB NSP1-1 fusion activity and interferon responses remains an open question:

  • NSP1-1 may indirectly impact interferon responses through cell fusion events

  • Studies using STAT1 knockout mice showed that NSP1-deficient rotaviruses remain attenuated even in the absence of interferon signaling, suggesting NSP1 plays roles beyond interferon antagonism

  • The NSP1-2 protein of RVB may serve interferon antagonist functions complementary to NSP1-1's fusion role

  • Species B, G, and I rotaviruses have evolved a two-protein NSP1 system that may provide functional advantages

Understanding the interplay between these two aspects of viral host interaction could reveal new aspects of rotavirus pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.