Recombinant Rothia mucilaginosa Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Tat Pathway

The Tat pathway transports folded proteins across membranes, distinguishing it from the Sec pathway, which translocates unfolded proteins. TatC serves as the core component, recognizing twin-arginine (S/TRRXFLK) motifs in substrate signal peptides .

Key Functions of TatC

  • Substrate Recognition: Binds signal peptides via conserved regions (e.g., TM1 and TM5–TM6) .

  • Recruitment of TatA/TatB: Forms complexes with TatA and TatB to assemble the translocation pore .

  • Membrane Stability: Prevents ion leakage during transport through tightly regulated pore formation .

Comparison of Sec and Tat Pathways

FeatureSec PathwayTat Pathway
Protein StateUnfoldedFolded
Key ProteinsSecA, SecY, SecETatA, TatB, TatC
Substrate MotifHydrophobic signal sequenceTwin-arginine motif (S/TRRXFLK)
Energy SourceATP (via SecA)Proton motive force (PMF)
ApplicationsGeneral secretionExporting cofactor-dependent enzymes

Production and Quality Control

Recombinant TatC is produced via heterologous expression systems and purified using affinity chromatography.

Production Workflow

  1. Cloning: tatC gene amplified from R. mucilaginosa genomic DNA and inserted into expression vectors.

  2. Expression: Induced in E. coli (e.g., BL21(DE3)) or baculovirus-infected insect cells .

  3. Purification: His-tagged protein purified via Ni-NTA affinity chromatography .

  4. Quality Assurance:

    • Purity: Verified by SDS-PAGE (>85% pure) .

    • Storage: Tris-based buffer with 50% glycerol, stored at -20°C/-80°C .

Bacterial Virulence

  • Pathogen Export: TatC exports virulence factors (e.g., phospholipases in Pseudomonas aeruginosa) .

  • Antibiotic Resistance: Tat-dependent secretion of metallo-β-lactamases in Gram-negative bacteria .

Biotechnology

  • Protein Engineering: TatC used to optimize secretion of recombinant proteins (e.g., cofactor-dependent enzymes) .

  • ELISA Kits: Partial TatC recombinants (e.g., CSB-BP510644ROP1) employed in antibody detection assays .

Evolutionary Insights

Phylogenetic analyses reveal TatC diversification across bacterial classes, with isoforms (e.g., TatCd/TatCy in Bacilli) specializing in substrate transport . For example:

  • TatCy: Progenitor isoform in Bacilli, associated with general substrate secretion.

  • TatCd: Evolved for niche-specific transport (e.g., alkaline phosphatase) .

References

  1. Creative Biomart: Recombinant Rothia mucilaginosa TatC (RFL24681RF).

  2. Cbm15: ELISA Recombinant Rothia mucilaginosa TatC.

  3. PMC: Structure of the TatC core (Aquifex aeolicus).

  4. PMC: Tat involvement in Pseudomonas aeruginosa phospholipase secretion.

  5. PMC: The Bacterial Twin-Arginine Translocation Pathway.

  6. Wikipedia: Twin-arginine translocation pathway.

  7. Cusabio: Recombinant Rothia mucilaginosa TatC (partial).

  8. PMC: Diversity and Evolution of Bacterial TatC.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tatC; RMDY18_10430; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Rothia mucilaginosa (strain DY-18) (Stomatococcus mucilaginosus)
Target Names
tatC
Target Protein Sequence
MATPDQDVRNRKINPEARMELKEHLREFRDRLIKAAIATIIAAIIGTVFLYQPFIEMISA PLQQINIETGRRANLNYGSVASPFDQLLKVGMYIGLVIASPVWLYQALRFLLPALHTKEK KYLFGFLTASIFAFACGVAISYFTLPGVVYALLKFTPVNESNYIDAGVYISFILKFVVTF SCAFIIPVILVGINMLGLIRGKTILKSWRWVVVLVAVIAALTAPGSDIMMMFVLMAPLLI FFFAAIGICMINDKRRDRKLAKLAQGSDEASLNTATSSEDLAKMGYFEEEKTS
Uniprot No.

Target Background

Function

Recombinant Rothia mucilaginosa Sec-independent protein translocase protein TatC (tatC) is a component of the twin-arginine translocation (Tat) system. This system transports large, folded proteins across membranes. These proteins possess a characteristic twin-arginine motif within their signal peptide. TatC, along with TatB, forms a receptor that directly interacts with Tat signal peptides.

Database Links
Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rothia mucilaginosa and what is its clinical significance?

Rothia mucilaginosa is a Gram-positive coccus belonging to the Micrococcaceae family. Previously known as Stomatococcus mucilaginosus (until 2000), it naturally occurs as part of the normal flora of the oropharynx and upper respiratory tract . Although typically considered a commensal organism, R. mucilaginosa can cause serious infections, particularly in immunocompromised individuals.

Clinical significance of R. mucilaginosa includes:

  • Bacteremia, particularly in patients with neutropenia, malignancy (especially leukemia), and those with indwelling vascular devices

  • Lower respiratory tract infections, including pneumonia (though rare and primarily occurring in immunocompromised patients)

  • Potential for serious complications including septic shock, pneumonia, meningitis, and acute respiratory distress syndrome in vulnerable populations

A 10-year study at Mayo Clinic identified 67 adults with blood cultures positive for Rothia, with 25 patients having multiple positive blood cultures indicating true clinical infection. Among these confirmed cases, 88% were neutropenic and 76% had leukemia, demonstrating the organism's opportunistic nature in immunocompromised hosts .

What is the Tat (twin-arginine translocation) pathway and how does it differ from the Sec pathway?

The Tat (twin-arginine translocation) pathway is a specialized protein transport system that enables bacteria to translocate fully folded proteins across the cytoplasmic membrane. This pathway is fundamentally different from the more common Sec pathway in several important aspects:

  • Protein folding state: The Tat pathway translocates proteins that are already folded in the cytoplasm, while the Sec pathway transports unfolded proteins .

  • Energy requirements: The Tat pathway does not require ATP but depends on an intact membrane potential, whereas the Sec translocase requires ATP for function .

  • Signal peptide characteristics: Tat signal peptides contain a distinctive twin-arginine motif and are generally longer and less hydrophobic than Sec signal peptides .

  • Component proteins: The Tat system in many bacteria comprises TatA, TatB, and TatC proteins, while the Sec system has different component proteins including SecY .

The twin-arginine motif is particularly crucial for Tat pathway function; mutation of either arginine residue significantly reduces translocation efficiency, highlighting its importance in substrate recognition and targeting .

What are the essential components of a functional Tat pathway?

A functional Tat translocation system requires several key components:

  • Component proteins: Primarily TatA, TatB, and TatC, which form the translocation machinery. In some organisms, additional proteins like TatE may be present .

  • Membrane potential: An intact proton motive force across the membrane is essential for Tat-dependent protein translocation .

  • Twin-arginine signal peptides: These specialized signal sequences direct proteins to the Tat apparatus and feature the conserved twin-arginine motif .

Experimental reconstitution of the Tat system has demonstrated that overexpression of TatABC significantly enhances the efficiency of Tat-dependent protein translocation. This observation has been instrumental in developing in vitro assays for studying the Tat pathway .

How can recombinant R. mucilaginosa TatC be expressed and purified for structural and functional studies?

Expression and purification of recombinant R. mucilaginosa TatC presents several challenges due to its nature as a membrane protein. A methodological approach includes:

  • Expression system selection:

    • E. coli-based expression systems are commonly used for heterologous expression of bacterial membrane proteins

    • Consider using strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Expression vectors with tunable promoters (e.g., arabinose-inducible systems) can help control expression levels

  • Construct design:

    • Include affinity tags (His-tag or FLAG-tag) for purification

    • Consider fusion partners that enhance solubility or expression

    • Codon optimization for E. coli if necessary

  • Membrane extraction and solubilization:

    • Prepare inverted membrane vesicles (IMVs) through cell disruption and ultracentrifugation

    • Use mild detergents (DDM, LMNG, or digitonin) for membrane protein solubilization

    • Screen multiple detergents to optimize solubilization while maintaining protein structure

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) as initial purification step

    • Size exclusion chromatography for further purification and assessment of oligomeric state

    • Consider amphipol or nanodisc reconstitution for stability during structural studies

  • Functional verification:

    • In vitro reconstitution assays using purified TatC with synthetic lipids and other Tat components

    • Substrate binding assays using synthesized twin-arginine signal peptides

When designing expression systems, researchers should note that overexpression of TatABC (at least 32-fold enrichment compared to wild-type levels) has been shown to significantly enhance Tat-dependent translocation efficiency in reconstituted systems .

What experimental approaches can be used to study the interaction between R. mucilaginosa TatC and twin-arginine signal peptides?

Several complementary approaches can be employed to investigate TatC-signal peptide interactions:

  • In vitro binding assays:

    • Use synthetic peptides corresponding to the twin-arginine signal sequences

    • Employ fluorescence anisotropy or isothermal titration calorimetry to quantify binding affinities

    • Surface plasmon resonance (SPR) for real-time binding kinetics

  • Crosslinking studies:

    • Site-specific incorporation of photo-crosslinkable amino acids

    • Chemical crosslinking followed by mass spectrometry to identify interaction sites

    • In vivo crosslinking in heterologous expression systems

  • Mutagenesis approaches:

    • Systematic mutation of conserved residues in TatC

    • Mutation of the twin-arginine motif to confirm specificity

    • Creation of chimeric signal peptides to determine specificity determinants

  • Structural biology techniques:

    • Cryo-electron microscopy of TatC-peptide complexes

    • X-ray crystallography of co-crystallized complexes

    • NMR studies of labeled peptides with purified TatC

  • In vitro reconstitution assays:

    • Proteoliposome-based translocation assays with purified components

    • Inverted membrane vesicle (IMV) translocation assays

When designing mutation studies, it's important to note that the twin-arginine motif is crucial for translocation efficiency. Previous research has shown that mutation of either arginine residue within the signal peptide significantly reduces translocation efficiency, highlighting specific residues to target in interaction studies .

How does the function of the Tat pathway in R. mucilaginosa compare to other bacterial species?

While specific data on R. mucilaginosa's Tat pathway is limited in the provided search results, comparative analysis can be approached through:

  • Genomic comparison:

    • Analyze sequence conservation of TatA, TatB, and TatC proteins across species

    • Identify unique sequence motifs or structural features in R. mucilaginosa Tat components

    • Compare genomic organization of tat genes

  • Substrate repertoire:

    • Bioinformatic prediction of Tat substrates in R. mucilaginosa genome

    • Comparative analysis with known Tat substrates in model organisms like E. coli

    • Proteomics approaches to identify actual Tat-dependent secreted proteins

  • Functional conservation testing:

    • Heterologous expression of R. mucilaginosa Tat components in tat mutant E. coli strains

    • Cross-species complementation studies

    • Chimeric Tat system construction and functional testing

  • Environmental adaptation:

    • Analysis of Tat pathway function under conditions relevant to R. mucilaginosa's natural habitat (oral cavity, respiratory tract)

    • Comparative growth assays under various stress conditions

What in vitro systems can be established to study Tat-dependent protein translocation in R. mucilaginosa?

Development of in vitro Tat translocation systems for R. mucilaginosa should build upon established methods for other bacteria, with specific adaptations:

  • Inverted membrane vesicle (IMV) preparation:

    • Culture R. mucilaginosa under optimal conditions

    • Prepare IMVs through cell disruption and differential centrifugation

    • Consider overexpression of TatABC components to enhance translocation efficiency

  • Substrate preparation:

    • Identify and clone native R. mucilaginosa Tat substrates

    • Use coupled transcription-translation systems to synthesize radiolabeled or otherwise tagged substrates

    • Ensure substrates maintain their folded state prior to translocation attempts

  • Translocation assay setup:

    • Combine prepared IMVs with synthesized substrates

    • Provide necessary cofactors and energy sources (membrane potential)

    • Include appropriate controls (Tat-deficient IMVs, signal sequence mutants)

  • Detection methods:

    • Protease protection assays to distinguish translocated from non-translocated proteins

    • Western blotting for non-radiolabeled substrates

    • Fluorescence-based approaches for real-time monitoring

Based on previous work with E. coli, researchers should note that successful in vitro Tat translocation typically requires:

  • Enriched levels of Tat components (32-fold enrichment has been reported as effective)

  • An intact membrane potential (but not ATP)

  • The twin-arginine targeting motif within substrate signal peptides

ComponentPurposeKey Considerations
IMVsProvide membrane environmentOverexpression of TatABC enhances translocation
Substrate proteinTest translocationMust contain intact twin-arginine signal peptide
Energy sourceDrive translocationMembrane potential required, not ATP
Buffer systemMaintain physiological conditionspH, ionic strength appropriate for R. mucilaginosa
ControlsValidate resultsSignal peptide mutants, Tat-deficient IMVs

What approaches can be used to identify and characterize clinical isolates of R. mucilaginosa?

Accurate identification and characterization of R. mucilaginosa from clinical samples requires a multi-faceted approach:

  • Morphological and biochemical identification:

    • Gram staining (Gram-positive cocci)

    • Colony morphology assessment

    • Biochemical profiling (can be confused with Micrococcus, Streptococcus, or Staphylococcus)

    • MALDI-TOF mass spectrometry for rapid identification

  • Molecular identification methods:

    • 16S rRNA gene sequencing

    • Species-specific PCR assays

    • Whole genome sequencing for comprehensive characterization

  • Antimicrobial susceptibility testing:

    • Disk diffusion or broth microdilution methods

    • Special considerations for difficult-to-grow isolates (supplementation with 5% lysed horse blood)

    • Focus on clinically relevant antibiotics: vancomycin, beta-lactams, oxacillin

  • Clinical correlation criteria:

    • Multiple positive blood cultures to distinguish true infection from contamination

    • Assessment of patient risk factors (neutropenia, malignancy, indwelling devices)

    • Source identification (catheter-related, mucositis, gut translocation)

When interpreting antimicrobial susceptibility testing results, note that R. mucilaginosa isolates are generally susceptible to vancomycin and most beta-lactams, but resistance to oxacillin has been observed in significant proportions (4 of 6 tested isolates in one study) . Additionally, quinolone resistance may develop in patients on quinolone prophylaxis .

How can functional studies be designed to assess the role of TatC mutations in protein translocation?

To investigate the functional consequences of TatC mutations, researchers can implement the following approaches:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through sequence alignment

    • Create alanine scanning libraries across functional domains

    • Design mutations based on predicted structure-function relationships

  • Complementation assays:

    • Generate tatC deletion strains (if working with cultivable R. mucilaginosa)

    • Complement with plasmid-expressed wild-type or mutant tatC

    • Assess restoration of Tat-dependent phenotypes

  • In vitro translocation assays:

    • Prepare IMVs from strains expressing mutant TatC

    • Compare translocation efficiency with wild-type IMVs

    • Use multiple Tat substrates to assess substrate-specific effects

  • Protein-protein interaction studies:

    • Analyze how mutations affect TatC interactions with TatA, TatB, and substrates

    • Employ bacterial two-hybrid systems, co-immunoprecipitation, or FRET

    • Identify residues critical for complex formation

  • Structural analysis:

    • Investigate how mutations affect TatC folding and membrane integration

    • Employ limited proteolysis, circular dichroism, or structural studies

    • Correlate structural changes with functional defects

When designing complementation experiments, it is important to note that overexpression of TatABC (32-fold enrichment) has been shown to enhance Tat-dependent translocation, suggesting that expression levels should be carefully controlled and monitored .

How should researchers interpret clinical microbiology data related to R. mucilaginosa infections?

Accurate interpretation of R. mucilaginosa clinical data requires careful consideration of several factors:

  • Distinguishing true infection from contamination:

    • Multiple positive blood cultures suggest true infection over contamination

    • In one study, neutropenic patients were less likely to have a single positive blood culture than non-neutropenic patients, suggesting different clinical manifestations based on immune status

    • Consider patient risk factors (neutropenia, malignancy, indwelling devices)

  • Source identification:

    • Common sources include gut translocation, mucositis, and catheter-related infections

    • Correlation with clinical presentation and patient history

    • Additional cultures from potential sources (catheters, respiratory samples)

  • Risk stratification:

    • Higher risk in patients with:

      • Profound neutropenia (88% of confirmed infections in one study)

      • Hematological malignancies, particularly leukemia (76% of cases)

      • Indwelling vascular devices

      • Mucosal barrier disruption due to chemotherapy

  • Antimicrobial susceptibility interpretation:

    • Generally susceptible to vancomycin and most beta-lactams

    • Variable resistance to oxacillin (4/6 isolates resistant in one study)

    • Potential for quinolone resistance in patients on prophylaxis

    • Technical challenges in susceptibility testing due to poor growth in vitro

Patient CharacteristicFrequency in Confirmed InfectionsClinical Implication
Neutropenia88% (22/25)Primary risk factor
Leukemia76% (19/25)Most common underlying condition
MucositisCommon (exact % not provided)Potential entry route
Indwelling catheterCommon (exact % not provided)Potential entry route/focus
Mortality attributable to infectionLow (1 patient in study)Generally manageable with appropriate therapy

What analytical approaches can be used to assess the efficiency of heterologously expressed R. mucilaginosa TatC?

To evaluate the functionality of recombinant R. mucilaginosa TatC in heterologous systems, researchers can employ several analytical approaches:

  • Quantitative translocation assays:

    • Measure translocation efficiency using model Tat substrates (e.g., SufI)

    • Compare translocation rates between native and R. mucilaginosa TatC

    • Analyze kinetics of translocation under varying conditions

  • Expression level correlation:

    • Quantify TatC expression levels using Western blotting

    • Correlate expression levels with translocation efficiency

    • Determine minimum expression threshold for functional complementation

  • Complex formation analysis:

    • Assess ability of R. mucilaginosa TatC to form complexes with host TatA/B

    • Use blue native PAGE or co-immunoprecipitation

    • Compare complex stability and composition with native complexes

  • Membrane integration assessment:

    • Confirm proper membrane topology using protease accessibility assays

    • Employ fluorescence-based approaches to verify membrane localization

    • Compare with native TatC localization patterns

  • Substrate binding analysis:

    • Measure binding affinity for twin-arginine signal peptides

    • Compare specificity for different Tat substrates

    • Identify any species-specific preferences

Previous research with E. coli has demonstrated that meaningful in vitro translocation assays require enriched levels of Tat components. Specifically, a 32-fold enrichment of TatABC in membrane vesicles compared to wild-type levels has been shown to significantly enhance translocation efficiency . This benchmark can serve as a reference point when assessing R. mucilaginosa TatC function.

What emerging techniques hold promise for advancing our understanding of R. mucilaginosa TatC function?

Several cutting-edge approaches show potential for deepening our understanding of R. mucilaginosa TatC:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural analysis of TatC and Tat complexes

    • Visualization of conformational changes during translocation

    • Structural comparison with TatC from other species

  • Single-molecule techniques:

    • FRET-based approaches to monitor TatC-substrate interactions in real-time

    • Optical tweezers to measure forces during protein translocation

    • Super-resolution microscopy to visualize Tat complex dynamics in membranes

  • Systems biology approaches:

    • Transcriptomics to identify Tat-dependent genes under various conditions

    • Proteomics to comprehensively catalog Tat substrates

    • Metabolomics to assess global effects of Tat pathway dysfunction

  • Synthetic biology tools:

    • Designer Tat substrates with tunable properties

    • Minimal Tat systems with defined components

    • Engineered signal peptides to probe recognition determinants

  • Computational methods:

    • Molecular dynamics simulations of TatC-substrate interactions

    • Machine learning approaches to predict Tat substrates

    • Evolutionary analysis to understand species-specific adaptations

The development of in vitro reconstitution systems that successfully demonstrate Tat-dependent translocation has been a significant advancement in the field . Building on this foundation with these emerging techniques will likely yield important insights into the mechanistic details of Tat translocation in R. mucilaginosa.

How might characterization of R. mucilaginosa TatC contribute to our understanding of bacterial pathogenesis?

Understanding R. mucilaginosa TatC function may illuminate several aspects of bacterial pathogenesis:

  • Virulence factor secretion:

    • Identification of Tat-dependent virulence factors in R. mucilaginosa

    • Comparison with known pathogenic mechanisms in other opportunistic pathogens

    • Correlation between Tat efficiency and clinical outcomes

  • Host-pathogen interactions:

    • Role of Tat-secreted proteins in colonization of mucosal surfaces

    • Potential for Tat substrates in immune evasion or modulation

    • Contribution to biofilm formation and persistence

  • Environmental adaptation:

    • Function of Tat pathway under host-relevant conditions (nutrient limitation, oxidative stress)

    • Role in transition from commensal to pathogenic state

    • Adaptation to specific host niches (oral cavity, respiratory tract)

  • Therapeutic targeting potential:

    • Assessment of Tat pathway as a novel antimicrobial target

    • Identification of inhibitors specific to R. mucilaginosa TatC

    • Potential for attenuating virulence without affecting viability

R. mucilaginosa infections are particularly significant in immunocompromised patients, with 88% of confirmed bacteremia cases occurring in neutropenic patients and 76% in patients with leukemia . Understanding the role of the Tat pathway in this context may reveal how this normally commensal organism adapts to cause opportunistic infections in vulnerable hosts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.