Recombinant Rousettus leschenaultii Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless otherwise requested. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Rousettus leschenaultii (Leschenault's rousette)
Target Names
Target Protein Sequence
MAYPFQLGFQDATSPIMEELLHFHDHALMIVFLISSLVLYLISVMLTTSLTHTSTMDAQE VETIWTILPAMILIMIALPSLRILYMMDEINNPYLTVKTMGHQWYWSYEYTDYEDMSFDS YMVPTQDLKPGELRLLEVDNRVVLPMELTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLLSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSSSML
Uniprot No.

Target Background

Function

Recombinant Rousettus leschenaultii Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work in concert to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme a of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) composed of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in cellular respiration?

MT-CO2 (also known as COII, COXII, or Cytochrome c oxidase polypeptide II) is the second subunit of cytochrome c oxidase (Complex IV) in the mitochondrial respiratory chain. This protein plays a crucial role in the final step of the electron transport chain, catalyzing the reduction of oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane to contribute to the electrochemical gradient necessary for ATP production . In Rousettus leschenaultii, as in other eukaryotes, this protein is encoded by the mitochondrial genome and functions as part of the multi-subunit enzyme complex located in the inner mitochondrial membrane .

What are the optimal conditions for expressing recombinant Rousettus leschenaultii MT-CO2?

While specific expression conditions for Rousettus leschenaultii MT-CO2 are not explicitly detailed in the provided literature, best practices for mitochondrial membrane proteins generally involve:

  • Selecting an appropriate expression system (bacterial, yeast, insect, or mammalian) based on the need for post-translational modifications and proper folding

  • Using specialized vectors containing mitochondrial targeting sequences if expressing in eukaryotic systems

  • Optimizing codon usage for the expression host

  • Including affinity tags to facilitate purification while ensuring they don't interfere with protein function

  • Expression temperature optimization (typically lower temperatures of 16-25°C for membrane proteins to allow proper folding)

For MT-CO2 specifically, researchers should be aware that its proper assembly may require co-expression with other cytochrome c oxidase subunits or assembly factors to achieve a functional protein conformation .

What purification methods are effective for recombinant MT-CO2?

Purification of recombinant MT-CO2 typically follows these methodological steps:

  • Cell lysis under conditions that preserve protein structure and function

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (commonly digitonin, DDM, or LMNG for mitochondrial membrane proteins)

  • Affinity chromatography using the protein's affinity tag

  • Size exclusion chromatography to separate the protein from aggregates and other contaminants

  • Final concentration and buffer exchange into a storage buffer (typically Tris-based with 50% glycerol as used for commercial preparations)

When storing purified MT-CO2, it is recommended to keep it at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can Rousettus leschenaultii MT-CO2 be used in evolutionary studies?

Rousettus leschenaultii MT-CO2 serves as a valuable marker for evolutionary and phylogenetic studies due to several characteristics:

  • As a mitochondrial gene, MT-CO2 has a higher mutation rate than nuclear genes, making it useful for studying relatively recent evolutionary events

  • The conservation of functional domains amid sequence variation allows researchers to track evolutionary relationships

  • Comparison of MT-CO2 sequences among different Rousettus populations has revealed significant genetic differentiation between geographic regions

Research methodologies for evolutionary studies typically include:

  • PCR amplification of the MT-CO2 gene region using conserved primers

  • DNA sequencing of the amplified products

  • Sequence alignment and phylogenetic analysis using maximum likelihood, Bayesian inference, or other appropriate methods

  • Calculation of genetic distances between populations

  • Integration with other genetic markers (such as microsatellites) for comprehensive population genetics studies

Studies of Rousettus species have shown that MT-CO2 sequence data can help distinguish between populations from different geographic regions, with no shared haplotypes found between populations from different island groups .

What experimental approaches are used to study MT-CO2 assembly in mitochondrial complexes?

The assembly of MT-CO2 into functional cytochrome c oxidase complexes can be studied using several sophisticated approaches:

  • Metabolic labeling techniques: Using radioactive amino acids to track newly synthesized mitochondrial gene products, allowing researchers to follow the assembly process in real-time

  • Affinity purification of assembly intermediates: Tagging MT-CO2 or its assembly factors to isolate and characterize intermediate complexes formed during the assembly process

  • Blue native gel electrophoresis: Separating intact protein complexes to identify assembly intermediates and analyze their composition

  • Mass spectrometry: Identifying proteins associated with MT-CO2 during different stages of assembly

  • Genetic manipulation: Creating mutations in assembly factors to assess their impact on MT-CO2 incorporation into the respiratory complex

A comprehensive study of assembly would incorporate analysis of:

Assembly StageKey Factors InvolvedAnalytical Methods
TranslationSpecialized translation factorsRibosome profiling, pulse-chase analysis
Membrane InsertionOxa1, Cox18, Mss2Protease protection assays, fluorescence microscopy
Copper AssociationCox17, Sco1, Sco2Metal binding assays, spectroscopy
Module AssemblyCox20, assembly chaperonesCo-immunoprecipitation, BN-PAGE
Complex MaturationVarious assembly factorsActivity assays, structural analysis

How does Rousettus leschenaultii MT-CO2 compare to homologs in other species?

Comparative analysis of MT-CO2 across species reveals important evolutionary patterns and functional constraints:

Genetic distance analyses have shown that:

  • The average pairwise genetic distance between Rousettus populations from Madagascar and the Comoros Archipelago is at least 15 times larger than within each island group

  • These genetic differences support the classification of these populations as distinct species (R. madagascariensis and R. obliviosus)

  • Within-island genetic distances for Rousettus are only slightly less than the average genetic distance among all sequences from R. leschenaultii

Understanding these comparisons helps researchers interpret the functional significance of specific amino acid substitutions and structural variations.

What methodological approaches are used to study functional differences between MT-CO2 variants?

Several methodological approaches can be employed to investigate functional differences between MT-CO2 variants:

  • Enzymatic activity assays: Measuring cytochrome c oxidase activity using spectrophotometric methods to assess the impact of sequence variations on catalytic efficiency

  • Oxygen consumption measurements: Using respirometry to evaluate the functional consequences of MT-CO2 variants on cellular respiration

  • Electron transfer kinetics: Analyzing the rate of electron transfer through cytochrome c oxidase using stopped-flow spectroscopy or other kinetic approaches

  • Site-directed mutagenesis: Introducing specific amino acid substitutions to mimic natural variants and assess their functional impact

  • Structural analysis: Using X-ray crystallography or cryo-electron microscopy to determine how sequence variations affect protein structure

  • Thermal stability assays: Assessing how variants affect protein stability under different temperature conditions

These approaches can help researchers understand the functional significance of the genetic variations observed between Rousettus populations and other bat species .

What are common challenges in working with recombinant MT-CO2 and how can they be addressed?

Working with recombinant MT-CO2 presents several technical challenges:

  • Protein solubility: As a membrane protein, MT-CO2 has hydrophobic regions that can cause aggregation. Solution: Use appropriate detergents for solubilization and consider fusion tags that enhance solubility.

  • Proper folding: Ensuring correct folding of the recombinant protein. Solution: Optimize expression conditions, consider co-expression with chaperones, and use slow induction at lower temperatures.

  • Cofactor incorporation: Ensuring proper incorporation of the copper cofactor. Solution: Supplement expression medium with copper or reconstitute the cofactor post-purification.

  • Storage stability: Maintaining protein activity during storage. Solution: Store at -20°C or -80°C in buffer containing 50% glycerol, and avoid repeated freeze-thaw cycles .

  • Activity assessment: Verifying that the recombinant protein is functionally active. Solution: Develop appropriate activity assays that can work with the isolated subunit or reconstitute with other components of the complex.

What quality control measures should be implemented when working with recombinant Rousettus leschenaultii MT-CO2?

Comprehensive quality control for recombinant MT-CO2 should include:

  • Purity assessment: SDS-PAGE and western blotting to confirm protein identity and purity

  • Mass spectrometry: To verify the exact mass and sequence of the purified protein

  • Circular dichroism: To assess secondary structure and proper folding

  • Metal content analysis: Atomic absorption spectroscopy or ICP-MS to quantify copper incorporation

  • Functional assays: Electron transfer activity tests to confirm biological function

  • Thermal stability analysis: Differential scanning fluorimetry to assess protein stability

  • Aggregation analysis: Size exclusion chromatography or dynamic light scattering to check for protein aggregation

A typical quality control workflow might include:

Quality ParameterAnalytical MethodAcceptance Criteria
IdentityWestern blot, mass spectrometryMatch to expected sequence
PuritySDS-PAGE, SEC-HPLC>95% purity
HomogeneitySize exclusion chromatographySingle peak, minimal aggregation
Cofactor contentUV-Vis spectroscopy, metal analysisExpected copper:protein ratio
ActivityElectron transfer assayDefined minimum specific activity
StabilityAccelerated stability testingMinimal degradation under storage conditions

Implementing these quality control measures ensures consistent and reliable experimental results when working with this complex mitochondrial protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.