Recombinant Rubella virus Structural polyprotein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Structural polyprotein; p110
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
583-1063
Protein Length
Full Length of Mature Protein
Species
Rubella virus (strain M33) (RUBV)
Target Protein Sequence
EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYYLRGAIAP R
Uniprot No.

Target Background

Function

The capsid protein interacts with genomic RNA, assembling into icosahedral core particles (65-70 nm diameter). This nucleocapsid subsequently associates with the cytoplasmic domain of E2 at the cell membrane, leading to budding and the formation of mature virions from host Golgi membranes. Phosphorylation negatively regulates RNA-binding activity, potentially delaying virion assembly during viral replication. The capsid protein dimerizes and forms disulfide bonds within the virion. It modulates genomic RNA replication and subgenomic RNA synthesis by interacting with human C1QBP/SF2P32. Furthermore, it induces perinuclear mitochondrial clustering and the formation of electron-dense intermitochondrial plaques, characteristic of rubella virus-infected cells. Capsid protein expression in transfected cells induces apoptosis.

The E1 protein is responsible for viral attachment to the host cell via receptor binding. Its transport to the plasma membrane depends on its interaction with the E2 protein. The surface glycoproteins exhibit an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement. E1 is a class II viral fusion protein. Its fusion activity is inactive while bound to E2 in the mature virion. Following viral attachment and clathrin-mediated endocytosis, endosomal acidification induces E1/E2 heterodimer dissociation and E1 trimerization. This E1 homotrimer is fusion-active, facilitating the release of the viral nucleocapsid into the cytoplasm after endosome and viral membrane fusion. The cytoplasmic tail of the E1 spike glycoprotein modulates virus release. The surface glycoproteins display an irregular helical organization and a pseudo-tetrameric inner nucleocapsid arrangement.

Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host mitochondrion.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is the composition of the Rubella virus structural polyprotein?

The Rubella virus (RV) structural polyprotein, designated p110, is the precursor for all structural proteins of the virus. It undergoes specific enzymatic cleavages to yield three mature structural proteins:

  • Capsid protein (33 kDa): Forms the core of the virus particle

  • E2 glycoprotein (42-47 kDa): Involved in viral attachment

  • E1 glycoprotein (58 kDa): Mediates membrane fusion

These proteins are produced through proteolytic processing of the polyprotein precursor and each has distinct roles in the viral life cycle. The structural polyprotein is encoded by the 24S mRNA of the virus and translated as a single polypeptide before undergoing processing to yield the individual functional proteins .

How is the Rubella virus structural polyprotein processed in host cells?

The processing of the Rubella virus structural polyprotein involves a series of precise proteolytic cleavages mediated by cellular enzymes. Two signal peptidase-mediated cleavages within the polyprotein produce the structural proteins capsid, E2, and E1. After cleavage by the signal peptidase, the E2 signal peptide remains attached to the C-terminus of the capsid protein, which is a unique feature of Rubella virus processing. Additionally, another signal peptide at the E2 C-terminus directs E1 to the endoplasmic reticulum for proper folding and processing. This sequential cleavage process ensures the correct order of protein maturation and trafficking through the secretory pathway .

Studies in both mammalian and insect cell expression systems have demonstrated that this processing pathway is conserved, with polypeptides similar to those synthesized in RV-infected B-Vero cells also being expressed in lepidopteran insect cell lines infected with recombinant baculovirus containing the structural polyprotein genes .

What expression systems are commonly used for recombinant Rubella virus structural proteins?

Several expression systems have been successfully employed for the production of recombinant Rubella virus structural proteins, each with distinct advantages:

The choice of expression system depends on the research goals, with insect cell systems preferred when authentic processing and glycosylation are required, while bacterial systems may be more suitable for high-yield production of individual proteins for immunological studies.

What are the functional roles of individual structural proteins derived from the polyprotein?

Each structural protein cleaved from the Rubella virus polyprotein serves specific functions in the viral life cycle:

Capsid protein (33 kDa):

  • Interacts with genomic RNA and assembles into icosahedric core particles 65-70 nm in diameter

  • Associates with the cytoplasmic domain of E2 at the cell membrane, facilitating budding and formation of mature virions

  • Undergoes phosphorylation, which negatively regulates RNA-binding activity, possibly delaying virion assembly during viral replication

  • Forms dimers and becomes disulfide-linked in the virion

  • Modulates genomic RNA replication and subgenomic RNA synthesis through interaction with human C1QBP/SF2P32

  • Induces perinuclear clustering of mitochondria and formation of electron-dense intermitochondrial plaques

  • Triggers apoptosis when expressed in transfected cells

E2 glycoprotein (42-47 kDa):

  • Responsible for viral attachment to target host cells by binding to cellular receptors

  • Transport to the plasma membrane depends on interaction with E1 protein

  • Contributes to the irregular helical organization of surface glycoproteins and pseudo-tetrameric inner nucleocapsid arrangement

E1 glycoprotein (58 kDa):

  • Functions as a Class II viral fusion protein

  • Fusion activity remains inactive while E1 is bound to E2 in mature virions

  • After virus attachment and endocytosis, acidification of the endosome induces dissociation of E1/E2 heterodimer and trimerization of E1 subunits, activating fusion capability

  • The activated E1 homotrimer promotes fusion of viral and endosomal membranes, releasing the viral nucleocapsid into the cytoplasm

  • The cytoplasmic tail modulates virus release

What regulatory considerations apply to research with recombinant Rubella virus structural proteins?

Research involving recombinant Rubella virus structural proteins falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. These guidelines specify biosafety practices and containment principles for handling recombinant nucleic acid molecules, synthetic nucleic acid molecules, and cells, organisms, and viruses containing such molecules .

Key regulatory considerations include:

  • Institutional Biosafety Committee (IBC) approval requirements for experiments involving deliberate transfer of recombinant or synthetic nucleic acid molecules

  • Compliance with host country rules for research conducted abroad. If the host country lacks specific rules, the research must be reviewed and approved by an NIH-approved Institutional Biosafety Committee or equivalent body and accepted by an appropriate national governmental authority

  • Safety practices employed must be reasonably consistent with the NIH Guidelines

  • Institutions receiving NIH funding for recombinant or synthetic nucleic acid molecule research must ensure compliance with these guidelines for all such research conducted at or sponsored by the institution, regardless of funding source

Researchers should also note that commercial recombinant Rubella virus proteins are typically labeled "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES," indicating additional regulatory pathways would be needed for clinical applications .

How does glycosylation affect the functionality and immunogenicity of recombinant Rubella virus structural proteins?

Glycosylation plays a critical role in the functionality and immunogenicity of Rubella virus structural glycoproteins E1 and E2. Studies utilizing tunicamycin, an inhibitor of N-linked glycosylation, have demonstrated the importance of glycosylation for proper protein folding, trafficking, and function. When expressing the recombinant proteins in the presence and absence of tunicamycin, researchers have observed differences in protein processing and localization .

The glycosylation pattern affects:

  • Protein Folding and Stability: N-linked glycans contribute to the proper folding of E1 and E2 in the endoplasmic reticulum, preventing aggregation and misfolding that could trigger degradation.

  • Antigenicity and Immunogenicity: Glycan structures can either shield or expose epitopes, directly impacting the antibody recognition of viral proteins. Research comparing recombinant proteins expressed in different systems (bacterial versus insect or mammalian cells) reveals significant differences in recognition by human convalescent sera, suggesting that glycosylation patterns influence the presentation of conformational epitopes .

  • Viral Assembly and Budding: Proper glycosylation of E1 and E2 is essential for their interaction with each other and with the capsid protein, which ultimately affects viral particle assembly and budding from host Golgi membranes.

A methodological approach to studying glycosylation effects involves comparative expression in systems with different glycosylation capabilities (e.g., E. coli versus insect cells versus mammalian cells) followed by functional assays and structural analyses to determine the impact of glycosylation on protein properties and viral functions .

What are the challenges in maintaining native conformational epitopes in recombinant Rubella virus structural proteins?

Preserving native conformational epitopes in recombinant Rubella virus structural proteins presents several challenges that researchers must address:

  • Protein Folding Environment: The cellular environment significantly impacts protein folding. Bacterial expression systems like E. coli lack the sophisticated folding machinery and post-translational modification capabilities of eukaryotic cells, potentially resulting in proteins with non-native conformations. Insect cell systems (such as Sf9) provide an intermediate environment that more closely resembles mammalian cells but still with some differences in processing .

  • Disulfide Bond Formation: Rubella virus structural proteins, particularly the capsid protein, form dimers through disulfide linkages in the virion. Ensuring proper disulfide bond formation in recombinant systems is challenging but essential for maintaining native structure. Expression in reducing environments can disrupt these critical bonds .

  • Complex Assembly Requirements: The structural proteins naturally exist in complex arrangements - the capsid forms icosahedral particles, while E1 and E2 form heterodimers that arrange in an irregular helical organization on the virion surface. Recapitulating these complex assemblies in recombinant systems requires careful consideration of expression conditions and potential co-expression strategies .

  • Signal Sequence Processing: The unique processing of the E2 signal peptide, which remains attached to the capsid protein's C-terminus after cleavage, is difficult to reproduce in some expression systems. This attachment affects the conformational properties of the capsid protein and potentially its interaction with other viral components .

Researchers have addressed these challenges through several approaches:

  • Using codon-optimized sequences for the expression host

  • Employing eukaryotic expression systems for proteins requiring complex folding or post-translational modifications

  • Including molecular chaperones to assist with protein folding

  • Developing purification protocols that maintain native protein conformations

  • Validating conformational integrity through recognition by convalescent human sera and conformational antibodies

How does the proteolytic processing of the Rubella virus structural polyprotein differ from other viral polyproteins?

The proteolytic processing of the Rubella virus structural polyprotein (p110) exhibits several unique features that distinguish it from other viral polyproteins:

  • Retention of Signal Peptide: Unlike most viral polyproteins where signal peptides are completely removed during processing, the E2 signal peptide remains attached to the C-terminus of the capsid protein after cleavage by the signal peptidase. This retained peptide serves functional roles beyond its initial targeting function .

  • Host Cellular Proteases vs. Viral Proteases: While many viruses (such as picornaviruses and flaviviruses) encode their own proteases for polyprotein processing, Rubella virus relies entirely on host cellular signal peptidases for the cleavage of its structural polyprotein. This dependence on host machinery contrasts with its non-structural polyprotein processing, which utilizes a viral papain-like protease (RubPro) .

  • Sequential Processing Pattern: The processing of Rubella virus structural polyprotein follows a specific sequential pattern, with signal peptidase-mediated cleavages occurring in a defined order. This ordered processing ensures proper localization and assembly of the structural proteins .

  • Conserved Processing Across Host Species: Studies comparing the processing in mammalian cells (B-Vero) versus insect cells (Sf9) have demonstrated that the 24S transcription-translation unit of Rubella virus is expressed and proteolytically cleaved similarly, if not identically, across these evolutionarily distant host cells. This conservation suggests fundamental requirements for the processing pathway that are fulfilled by diverse eukaryotic cellular machineries .

  • Glycosylation-Independent Cleavage: While glycosylation affects the final conformation and function of E1 and E2 glycoproteins, the primary proteolytic cleavage events can occur even in the absence of glycosylation, as demonstrated by tunicamycin studies. This contrasts with some viral systems where glycosylation directly influences protease accessibility or recognition .

This unique processing pathway contributes to the distinctive assembly and structure of Rubella virions, which differ significantly from the more extensively studied alpha- and flaviviruses despite some shared features in genome organization.

What insights does the structure of Rubella virus protease provide for studying structural polyprotein processing?

While the Rubella virus papain-like protease (RubPro) primarily cleaves the non-structural polyprotein p200 rather than the structural polyprotein p110, understanding its structure provides valuable insights into viral polyprotein processing mechanisms:

The crystal structure of RubPro, resolved at 1.64 Å resolution, reveals:

  • Unique Structural Features: RubPro adopts a unique papain-like protease fold, with a catalytic core similar to proteases from SARS-CoV-2 and foot-and-mouth disease virus, but possessing a distinctive N-terminal fingers domain. This structural arrangement may represent conserved features among viral proteases that could inform our understanding of polyprotein processing mechanisms across viral families .

  • Catalytic Machinery: RubPro utilizes a catalytic dyad (C1152 and H1273) for its proteolytic activity, differing from the catalytic triads found in some other viral proteases. This mechanistic distinction may influence substrate specificity and processing efficiency .

  • Conservation Among Rubiviruses: The well-conserved sequence motifs found in RubPro across Rubivirus relatives suggest evolutionary pressure to maintain specific proteolytic mechanisms, which may extend to constraints on polyprotein design and processing across this virus family .

  • Trans-Cleavage Activity: RubPro demonstrates protease activity in trans against constructs of RUBV protease-helicase and fluorogenic peptides. This trans-cleavage capability suggests potential interplay between non-structural and structural protein processing pathways, where released active protease could theoretically influence structural polyprotein processing under certain conditions .

  • Deubiquitylation Activity: The discovery that RubPro possesses deubiquitylation activity suggests a role in modulating host innate immune responses. This immunomodulatory function potentially creates an environment more conducive to viral replication and could indirectly affect structural protein expression and processing by altering cellular conditions .

These structural and functional insights provide a framework for understanding viral protease specificity, which could inform the design of experiments targeting polyprotein processing pathways or the development of antivirals that could disrupt these critical viral processes .

How can researchers differentiate between properly processed and aberrant forms of recombinant Rubella virus structural proteins?

Differentiating between properly processed and aberrant forms of recombinant Rubella virus structural proteins requires a multi-faceted analytical approach:

  • Molecular Weight Analysis:

    • SDS-PAGE and Western blotting with antibodies directed against whole RV and individual structural proteins can identify proteins of expected molecular weights (capsid protein: 33 kDa; E2: 42-47 kDa; E1: 58 kDa)

    • Aberrant processing may be revealed by unexpected banding patterns or molecular weight shifts

    • Comparative analysis with proteins synthesized in RV-infected B-Vero cells serves as a reference for proper processing

  • Immunological Verification:

    • Recognition by human convalescent sera provides validation that recombinant proteins maintain conformational epitopes similar to those in natural infection

    • Differential recognition patterns by various antibodies can reveal structural discrepancies

  • Glycosylation Analysis:

    • Expression in the presence and absence of tunicamycin (an inhibitor of N-linked glycosylation) helps determine the glycosylation status of the proteins

    • Mass spectrometry can precisely characterize glycan structures and their attachment sites

    • Enzymatic deglycosylation (using PNGase F or Endo H) followed by mobility shift analysis can reveal the extent and type of glycosylation

  • Functional Assays:

    • For E1: Fusion activity assays can determine if the protein correctly undergoes pH-dependent conformational changes

    • For E2: Cell binding assays can verify receptor interaction capability

    • For capsid: RNA binding assays and dimerization studies can confirm proper folding and function

  • Structural Analysis:

    • Circular dichroism spectroscopy can assess secondary structure content

    • Limited proteolysis can probe the accessibility of cleavage sites in properly versus improperly folded proteins

    • In advanced cases, X-ray crystallography or cryo-electron microscopy may be employed to determine detailed structural characteristics

  • Subcellular Localization Studies:

    • Immunofluorescence microscopy of cells expressing recombinant proteins can reveal whether they localize to expected cellular compartments (e.g., ER, Golgi for glycoproteins)

    • Aberrant processing often leads to retention in incorrect cellular compartments or aggregation

A methodological approach combining these techniques provides comprehensive characterization of recombinant protein processing status and helps ensure that experimental outcomes accurately reflect authentic viral protein characteristics.

What strategies optimize the expression and purification of recombinant Rubella virus structural polyprotein in different host systems?

Optimizing expression and purification of recombinant Rubella virus structural polyprotein requires system-specific strategies:

Insect Cell Expression System (Spodoptera frugiperda)

Expression Optimization:

  • Use the polyhedrin gene promoter of baculovirus (AcNPV) for high-level expression

  • Optimize infection multiplicity (MOI) and harvest time to balance protein yield with proper processing

  • Consider co-expression with chaperones to enhance proper folding

  • Maintain cells at lower temperatures (27°C vs. standard 28-30°C) to slow protein synthesis and allow proper folding

Purification Strategy:

  • Initial clarification of cell lysates through differential centrifugation

  • Affinity chromatography using anti-Rubella antibodies or added affinity tags

  • Size exclusion chromatography to separate monomeric proteins from aggregates

  • Ion exchange chromatography for final polishing

Bacterial Expression System (Escherichia coli)

Expression Optimization:

  • Use of codon-optimized genes for E. coli

  • Expression of individual domains rather than full polyprotein

  • Fusion with solubility-enhancing partners (MBP, SUMO, thioredoxin)

  • Induction at lower temperatures (16-25°C) and reduced IPTG concentrations

  • Targeting to the periplasmic space for improved disulfide bond formation

Purification Strategy:

  • Inclusion body isolation and refolding protocols for insoluble proteins

  • Affinity purification using engineered tags (His, GST)

  • Proteolytic removal of fusion tags

  • Negative selection steps to remove E. coli contaminants

  • Endotoxin removal for immunological applications

Mammalian Cell Expression System

Expression Optimization:

  • Use of strong viral promoters (CMV, SV40)

  • Stable cell line development for consistent expression

  • Addition of secretion signal sequences for improved trafficking

  • Supplementation with protein disulfide isomerase to enhance proper disulfide formation

Purification Strategy:

  • Collection of secreted proteins from culture media

  • Immunoaffinity chromatography

  • Lectin affinity chromatography to capture glycosylated proteins

  • Multi-step chromatography for separation of properly processed forms

Expression Validation Table:

SystemAdvantagesDisadvantagesTypical YieldProcessing Fidelity
Insect cellsNative-like glycosylation, Proper folding, Authentic processingLonger production time, Complex media requirements5-20 mg/LHigh - Similar to B-Vero cells
E. coliRapid growth, High yield, Simple media, Cost-effectiveLimited post-translational modifications, Inclusion body formation50-100 mg/LLow - Requires refolding
Mammalian cellsAuthentic glycosylation, Native conformation, Proper traffickingLowest yield, Highest cost, Slow growth1-5 mg/LHighest - Identical to viral infection

The optimal system choice depends on the intended application, with E. coli suitable for antigenicity studies and applications requiring high protein quantities, while insect or mammalian systems are preferred when authentic processing and conformation are critical .

What analytical methods are most effective for characterizing the structure-function relationships of recombinant Rubella virus structural proteins?

A comprehensive analytical toolkit is essential for elucidating structure-function relationships of recombinant Rubella virus structural proteins:

1. Structural Characterization Methods:

Primary Structure Analysis:

  • Mass spectrometry (MS) for accurate molecular weight determination and protein identification

  • N-terminal sequencing to confirm proper signal peptide cleavage

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for mapping post-translational modifications and verification of processing sites

Secondary and Tertiary Structure Analysis:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content (α-helices, β-sheets)

  • Fourier-transform infrared spectroscopy (FTIR) for complementary secondary structure information

  • Intrinsic fluorescence spectroscopy to probe tertiary structure and conformational changes

  • Differential scanning calorimetry (DSC) to determine thermal stability and domain organization

Quaternary Structure Analysis:

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Analytical ultracentrifugation for studying assembly intermediates

  • Negative-stain electron microscopy for visualizing capsid assembly and glycoprotein arrangements

  • Cross-linking coupled with mass spectrometry (XL-MS) to map protein-protein interactions

2. Functional Characterization Methods:

Capsid Protein:

  • RNA gel-shift assays to measure genomic RNA binding affinity

  • Immunofluorescence microscopy to assess mitochondrial clustering induction

  • Flow cytometry with annexin V staining to quantify apoptosis induction

  • Co-immunoprecipitation to investigate interactions with host factors (e.g., C1QBP/SF2P32)

E2 Glycoprotein:

  • Cell binding assays to measure receptor interaction

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Protein-protein interaction assays to study E2-E1 heterodimerization

  • Immunofluorescence to track cellular trafficking

E1 Glycoprotein:

  • Liposome fusion assays to measure pH-dependent fusion activity

  • Conformational antibody binding to detect pH-triggered structural changes

  • Trypsin resistance assays to monitor fusion-associated conformational changes

  • Fluorescence resonance energy transfer (FRET) to study E1 trimerization kinetics

3. Structure-Function Correlation Approaches:

Site-Directed Mutagenesis Studies:

  • Alanine scanning of functional domains

  • Cysteine substitution for disulfide mapping

  • Glycosylation site mutations to assess the role of specific glycans

  • Charge-reversal mutations to probe electrostatic interactions

Domain Swapping and Chimeric Proteins:

  • Creation of chimeras between related viral proteins to identify functional domains

  • Systematic truncation analysis to map minimal functional regions

Real-Time Structure-Function Analysis:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamic structural changes

  • Single-molecule FRET to monitor conformational transitions in real-time

  • Time-resolved electron microscopy to capture assembly intermediates

The most effective analytical strategy typically involves a multi-method approach that integrates structural data at various resolutions with functional readouts, building a comprehensive understanding of how structural features relate to specific functions in the viral life cycle .

How can researchers develop effective immunological tools for detecting properly processed recombinant Rubella virus structural proteins?

Developing effective immunological tools for detecting properly processed Rubella virus structural proteins requires strategic approaches to antibody generation and validation:

Strategic Antigen Design

For Conformation-Dependent Epitopes:

  • Use natively folded proteins expressed in eukaryotic systems (insect or mammalian cells)

  • Preserve critical post-translational modifications, particularly glycosylation

  • Stabilize native protein conformations through careful buffer optimization

For Linear Epitopes and Processing-Specific Antibodies:

  • Design peptides spanning protein junctions (cleavage sites)

  • Create neo-epitope peptides that are only exposed after proper processing

  • Develop antibodies that specifically recognize the E2 signal peptide retained at the capsid C-terminus

Antibody Generation Approaches

Polyclonal Antibodies:

  • Immunize animals (rabbits, guinea pigs) with purified recombinant proteins

  • For processing-specific antibodies, use junction peptides conjugated to carrier proteins

  • Implement affinity purification against specific domains or epitopes

Monoclonal Antibodies:

  • Screen hybridoma clones for recognition of native vs. denatured proteins

  • Select clones that differentiate between processed and unprocessed forms

  • Validate with properly processed proteins from RV-infected B-Vero cells as reference standard

Recombinant Antibodies:

  • Isolate B cells from convalescent patients for antibody gene cloning

  • Create phage-display libraries from immune donors

  • Perform guided selection against conformational epitopes

Comprehensive Validation Strategy

Cross-Reactivity Analysis:

  • Test against proteins from related viruses to ensure specificity

  • Evaluate recognition of various expression system products (bacterial, insect, mammalian)

  • Determine reactivity with denatured vs. native proteins

Epitope Mapping:

  • Utilize peptide arrays to define linear epitopes

  • Employ hydrogen-deuterium exchange mass spectrometry for conformational epitope mapping

  • Use competition assays with known epitope-specific antibodies

Functional Validation:

  • Verify neutralization capability for antibodies targeting functional domains

  • Confirm ability to detect trafficking-competent proteins via immunofluorescence

  • Assess correlation between antibody binding and functional assay results

Application-Specific Optimization

For Western Blotting:

  • Optimize sample preparation to preserve or denature epitopes as needed

  • Determine optimal blocking conditions to minimize background

  • Establish protocols for distinguishing glycosylated forms

For Immunofluorescence:

  • Develop fixation protocols that preserve conformational epitopes

  • Optimize permeabilization conditions for accessing internal epitopes

  • Validate subcellular localization patterns against known trafficking pathways

For ELISA and Immunocapture:

  • Design sandwich ELISA formats with capture/detection antibody pairs

  • Develop quantitative standards using purified recombinant proteins

  • Create assays specific for properly processed heterodimeric complexes (E1-E2)

By implementing these strategic approaches, researchers can develop immunological tools that reliably distinguish properly processed recombinant Rubella virus structural proteins from aberrant forms, facilitating both basic research and applied studies such as vaccine development .

What approaches can researchers use to study the interaction between Rubella virus structural proteins and host factors?

Studying interactions between Rubella virus structural proteins and host factors requires multiple complementary approaches:

Protein-Protein Interaction Discovery Methods

Affinity Purification-Mass Spectrometry (AP-MS):

  • Express tagged recombinant structural proteins (capsid, E1, E2) in relevant cell lines

  • Perform pulldown experiments followed by mass spectrometry identification

  • Include appropriate controls (tag-only, irrelevant viral protein) to filter out non-specific interactions

  • Compare interactomes across different cell types to identify cell-type-specific interactions

Proximity-Based Labeling:

  • Fuse BioID (biotin ligase) or APEX2 (peroxidase) to viral structural proteins

  • Express in host cells to biotinylate proteins in close proximity

  • Purify biotinylated proteins and identify by mass spectrometry

  • This approach captures transient and weak interactions missed by traditional pulldowns

Yeast Two-Hybrid Screening:

  • Use viral structural protein domains as bait

  • Screen against human cDNA libraries

  • Verify interactions with secondary assays

  • Particularly useful for identifying binary interactions

Validation and Characterization Methods

Co-Immunoprecipitation (Co-IP):

  • Verify protein-protein interactions in cellular contexts

  • Use antibodies against either viral or host proteins

  • Perform reciprocal IPs to strengthen evidence

  • Include RNase treatment to distinguish RNA-mediated interactions

Bioluminescence Resonance Energy Transfer (BRET) and Fluorescence Resonance Energy Transfer (FRET):

  • Create fusion constructs with luminescent/fluorescent proteins

  • Measure energy transfer as indication of proximity

  • Use in live cells to study dynamics of interactions

  • Quantify interaction strengths through titration experiments

Cellular Co-localization:

  • Perform immunofluorescence or live-cell imaging

  • Quantify co-localization using Pearson's correlation coefficient

  • Track dynamic changes in localization during infection

  • Particularly relevant for studying capsid-induced mitochondrial clustering

Functional Characterization Approaches

RNA Interference and CRISPR Screens:

  • Deplete host factors through siRNA or CRISPR-Cas9

  • Assess effects on viral protein localization, processing, and function

  • Perform rescue experiments with mutant variants

  • Particularly relevant for studying the capsid protein's interaction with C1QBP/SF2P32 in modulating subgenomic RNA synthesis

Dominant-Negative Mutants:

  • Express truncated or mutated host factors

  • Observe effects on viral protein function

  • Map interaction domains through systematic truncation

In Vitro Reconstitution:

  • Purify recombinant viral and host proteins

  • Reconstitute functional complexes in vitro

  • Perform biochemical assays to assess functional consequences

  • Determine structural features through cryo-EM or crystallography

Systems-Level Analysis

Transcriptomics and Proteomics:

  • Compare global changes in cells expressing individual viral structural proteins

  • Identify downstream effects of specific host-factor interactions

  • Perform time-course analyses to capture dynamic responses

Pathway Analysis:

  • Map identified host factors to cellular pathways

  • Perform enrichment analysis to identify key targeted processes

  • Connect to known virus-induced cellular changes (e.g., apoptosis induction by capsid protein)

Comparative Interactomics:

  • Compare host-factor interactions across related viruses

  • Identify conserved versus virus-specific interactions

  • Correlate with pathogenicity or tissue tropism differences

These multi-faceted approaches allow researchers to not only identify host factors interacting with Rubella virus structural proteins but also understand the functional consequences of these interactions in the context of viral replication, immune evasion, and pathogenesis .

What experimental approaches can assess the effectiveness of recombinant Rubella virus structural proteins for vaccine development?

Evaluating recombinant Rubella virus structural proteins for vaccine applications requires a comprehensive assessment framework spanning molecular characterization to clinical studies:

Structural and Antigenic Characterization

Conformational Analysis:

  • Compare recombinant proteins with native viral antigens using conformation-sensitive antibodies

  • Perform circular dichroism spectroscopy and thermal stability studies

  • Assess proper disulfide bond formation through non-reducing SDS-PAGE

  • Analyze glycosylation patterns using mass spectrometry

Epitope Mapping:

  • Identify neutralizing epitopes using monoclonal antibody panels

  • Compare epitope accessibility between recombinant and native proteins

  • Use competition assays with human convalescent sera to assess immunodominant epitope presentation

  • Evaluate epitope stability under various storage and formulation conditions

In Vitro Immunological Evaluation

Antibody Recognition:

  • Test recognition by human convalescent sera as a benchmark for authenticity

  • Perform comparative ELISAs using sera from naturally infected individuals

  • Assess cross-reactivity with related viruses to evaluate specificity

  • Measure avidity of induced antibodies as predictor of protection

Cellular Immune Response:

  • Evaluate T cell epitope presentation using dendritic cell presentation assays

  • Measure activation of CD4+ and CD8+ T cells by protein-loaded antigen presenting cells

  • Assess cytokine profiles induced by candidate antigens

  • Characterize memory T cell responses in previously infected or vaccinated individuals

Animal Model Testing

Immunogenicity Assessment:

  • Evaluate dose-dependent antibody responses in suitable animal models

  • Measure neutralizing antibody titers using plaque reduction neutralization tests

  • Assess duration of antibody response through longitudinal sampling

  • Characterize quality of antibody response (isotype, affinity maturation)

Challenge Studies:

  • Conduct protection studies in appropriate animal models

  • Evaluate sterilizing immunity versus disease modification

  • Assess maternal antibody transfer and protection of offspring

  • Compare protection with licensed Rubella vaccines as benchmark

Formulation Optimization:

  • Test various adjuvant combinations to enhance immunogenicity

  • Evaluate prime-boost strategies with different protein combinations

  • Assess stability and potency under various storage conditions

  • Develop thermostable formulations for global vaccine deployment

Comparative Vaccine Platforms Evaluation

Comparison Table of Vaccine Approaches:

PlatformAdvantagesLimitationsKey Assessment Parameters
Recombinant protein subunitSafety, defined composition, focused immune responseMay require adjuvants, multiple dosesConformational authenticity, adjuvant requirement
Virus-like particles (VLPs)Particulate nature, multiple epitopes, no genomeComplex production, potential aggregationAssembly efficiency, epitope display, stability
DNA/RNA vaccines encoding structural proteinsSimple production, in vivo expressionVariable expression, delivery challengesIn vivo expression levels, protein processing
Viral vector expressing structural proteinsStrong immunogenicity, single dose potentialPre-existing vector immunity, regulatory complexityTransgene stability, vector interference

Clinical Development Considerations

Safety Monitoring:

  • Screen for potential autoimmune cross-reactivity

  • Evaluate local and systemic adverse events

  • Assess reactogenicity compared to licensed vaccines

  • Monitor for enhanced disease upon natural exposure

Correlates of Protection:

  • Measure neutralizing antibody titers as established correlate of protection

  • Compare with internationally standardized units (15 IU/ml as protective threshold)

  • Evaluate consistency of immune response across diverse populations

  • Assess response in special populations (immunocompromised, pregnant women)

Regulatory Requirements:

  • Design studies compliant with regulatory guidelines for vaccine development

  • Establish manufacturing processes meeting Good Manufacturing Practice (GMP)

  • Develop quality control assays for batch release

  • Adhere to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules

These integrated approaches provide a comprehensive framework for evaluating whether recombinant Rubella virus structural proteins can serve as effective and safe vaccine antigens, potentially leading to improved vaccines with defined composition and enhanced manufacturing capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.