Recombinant Rubrobacter xylanophilus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Role

ATP synthase subunit a (atpB) is encoded by the atpB gene (locus tag: Rxyl_1638) in Rubrobacter xylanophilus. As part of the F0_0 domain, it forms the proton channel integral to the enzyme’s function . Key features include:

  • Molecular Function: Facilitates proton transport across the membrane, enabling ATP synthesis via the proton gradient .

  • Domain Architecture: Predicted transmembrane helices typical of F0_0 subunit a, conserved across bacterial species.

  • Subunit Interactions: Directly associates with other F0_0 subunits (e.g., subunits b, c) and F1_1 components (e.g., γ, δ chains) .

Recombinant Production and Characterization

While direct data on recombinant atpB is limited in the provided sources, insights can be inferred from related ATP synthase subunits (e.g., atpG, atpH, atpD) produced in R. xylanophilus:

ParameterDetails
Expression SystemLikely produced in E. coli or yeast systems (based on homologous subunits) .
TaggingMay include affinity tags (e.g., His-tag) for purification, as seen in atpG and atpH .
Purity>85% (SDS-PAGE verified for atpG) .
StorageLyophilized form: 12 months at -20°C/-80°C; liquid form: 6 months under similar conditions .
ReconstitutionRequires sterile water or glycerol-containing buffers to stabilize solubility .

3.1. Extremophilic Adaptations

R. xylanophilus thrives in extreme environments (thermophilic, radiation-resistant), and its ATP synthase likely exhibits unique stability. Subunit a’s proton-channel function may contribute to energy efficiency under stress .

3.2. Biotechnological Relevance

  • Enzyme Engineering: Recombinant ATP synthase subunits are tools for studying rotational catalysis mechanisms .

  • Stress Response Studies: Linked to trehalose and mannosylglycerate synthesis pathways, which protect against osmotic stress .

Comparative Genomic Insights

The atpB gene is part of a conserved operon structure in R. xylanophilus, alongside other ATP synthase genes (e.g., atpA, atpG, atpH) . This organization underscores its essential role in oxidative phosphorylation.

Unresolved Questions and Future Directions

  • Structural Details: High-resolution structures of atpB are needed to elucidate proton-channel mechanics.

  • Role in Polyhydroxyalkanoate (PHA) Synthesis: ATP synthase may supply energy for PHA production, a trait observed in Rubrobacter .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure a specific tag, please inform us in advance; we will prioritize its development.
Synonyms
atpB; Rxyl_1644; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)
Target Names
atpB
Target Protein Sequence
MEVTQEELRHEILHTWEAAREAWVIHLEIAGINLSINKPVWFLWLGAAITFLFMYVGART LRDRPGAYQVLVEELFRFGRDMFGGQINEEGRKWFPYSLTLFIFLLVLNIIGLFPNSYPV TSNISFTATLALFTFVLTQYEGVRRNGLVTYLKSWAPADLPAKPLMYPIMWFLHLIQEFT KPLTLALRLYANILAGHLIIFVFLSLILYFGLPTAFVSVPFAVVFYAFEIFVAVIQAYIF AILTQVYIELAMFAEEAH
Uniprot No.

Target Background

Function

Key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rubrobacter xylanophilus and why is it significant for research?

Rubrobacter xylanophilus is a thermophilic, halotolerant, and extremely radiation- and desiccation-resistant bacterium belonging to the phylum Actinobacteria . It represents one of the most ancient lineages of actinobacteria and has adapted to survive in extreme environments . This organism is particularly significant because it exhibits remarkable resistance to multiple environmental stressors, making it an excellent model for studying adaptations to extreme conditions .

R. xylanophilus constitutively accumulates trehalose as a major organic solute under optimal growth conditions as well as under salt and thermal stresses, which contributes to its extremophilic characteristics . The organism contains multiple pathways for trehalose synthesis, demonstrating sophisticated metabolic adaptations . Its remarkable resilience makes it valuable for understanding evolutionary adaptations to harsh environments.

What is the function of ATP synthase subunit a (atpB) in R. xylanophilus?

ATP synthase subunit a (atpB) is a critical membrane-embedded component of the F0 sector of ATP synthase in R. xylanophilus. The protein plays an essential role in proton translocation across the membrane during ATP synthesis . Based on its amino acid sequence, the R. xylanophilus atpB contains multiple transmembrane domains that form part of the proton channel .

The protein's full amino acid sequence (258 residues) contains hydrophobic regions typical of membrane proteins, consistent with its function in the membrane-embedded portion of ATP synthase . The protein participates in converting the energy of an electrochemical proton gradient into mechanical energy that drives ATP synthesis, a fundamental process for cellular energy production in this extremophile.

What expression systems are most suitable for producing recombinant R. xylanophilus atpB?

For expression of recombinant R. xylanophilus atpB, several systems can be considered, with Escherichia coli being the most commonly used for initial attempts. When expressing proteins from extremophiles, it's critical to consider the following methodological approaches:

  • Expression vector selection: Vectors containing T7 promoters with tight regulation (pET series) are often suitable for membrane protein expression.

  • Host strain optimization: E. coli C41(DE3) or C43(DE3) strains, which are derivatives of BL21(DE3), are specifically designed for membrane protein expression and can reduce toxicity issues.

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve the yield of properly folded membrane proteins.

  • Solubilization strategy: Membrane proteins like atpB require detergent solubilization. Non-ionic detergents like DDM (n-dodecyl β-D-maltoside) or LDAO (lauryldimethylamine oxide) are frequently effective for ATP synthase components.

For R. xylanophilus proteins specifically, protocols similar to those used for other bacterial ATP synthase components can be adapted, with modifications to account for the protein's thermophilic origin .

What are the optimal storage conditions for recombinant R. xylanophilus atpB protein?

For optimal stability, recombinant R. xylanophilus atpB protein should be stored in a Tris-based buffer containing 50% glycerol . The recommended storage temperature is -20°C for routine use, while -80°C is preferable for extended storage periods .

Important methodological considerations include:

  • Avoiding repeated freeze-thaw cycles: Working aliquots should be prepared and stored at 4°C for up to one week to avoid protein degradation .

  • Buffer optimization: The storage buffer composition should be optimized specifically for this protein, with glycerol serving as a cryoprotectant.

  • Concentration factors: Optimal protein concentration for storage typically ranges from 1-5 mg/ml to prevent aggregation while maintaining sufficient concentration for experimental use.

The thermostability of proteins from R. xylanophilus may confer greater storage stability compared to mesophilic homologs, but proper storage conditions remain essential for maintaining functional integrity.

How does the amino acid sequence of R. xylanophilus atpB reflect adaptations to extreme environments?

The amino acid sequence of R. xylanophilus atpB provides insights into molecular adaptations to extreme conditions. Analysis of the 258-amino acid sequence reveals several features typical of proteins adapted to thermophilic conditions :

  • Hydrophobic core composition: The sequence MEVTQEELRHEILHTWEAAREAWVIHLEIAGINLSINKPVWFLWLGAAITFLFMYVGART contains an elevated proportion of hydrophobic residues that likely contribute to thermal stability through enhanced hydrophobic interactions.

  • Charged residue distribution: The presence of glutamic acid (E) and arginine (R) residues in specific positions may contribute to salt bridge formation, which enhances protein stability under high-temperature conditions.

  • Transmembrane domain characteristics: The sequence contains multiple hydrophobic stretches consistent with transmembrane domains, which may have adaptations specific to membrane integrity under thermal stress.

Comparative analysis with atpB from mesophilic organisms would reveal specific substitutions that contribute to extremophilic adaptations. This approach has been used successfully to analyze other proteins from R. xylanophilus, such as those involved in trehalose synthesis pathways .

What analytical techniques are most effective for studying recombinant R. xylanophilus atpB structure and function?

Multiple complementary analytical approaches are recommended for comprehensive characterization of recombinant R. xylanophilus atpB:

  • Structural analysis:

    • Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins like atpB, allowing visualization within the ATP synthase complex

    • Circular dichroism (CD) spectroscopy: For analyzing secondary structure content and thermal stability

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To probe dynamic regions and solvent accessibility

  • Functional characterization:

    • Reconstitution into proteoliposomes: To measure proton translocation and ATP synthesis activity

    • Patch-clamp electrophysiology: To assess proton channel activity

    • ATP synthesis assays: To measure functional activity under varying temperature and salt conditions

  • Interaction studies:

    • Cross-linking coupled with mass spectrometry: To identify interaction partners and interfaces

    • Surface plasmon resonance (SPR): To determine binding kinetics with other ATP synthase subunits

When applying these techniques to atpB from extremophiles like R. xylanophilus, it's essential to consider temperature, pH, and ionic strength parameters that reflect the organism's native environment.

How can site-directed mutagenesis of R. xylanophilus atpB inform our understanding of extremophilic adaptations?

Site-directed mutagenesis represents a powerful approach to probe structure-function relationships in R. xylanophilus atpB and understand extremophilic adaptations. A methodological framework includes:

  • Target selection strategies:

    • Identify conserved residues across all ATP synthase a-subunits

    • Identify residues unique to thermophilic and radiation-resistant organisms

    • Focus on residues in the proton channel and at subunit interfaces

  • Recommended mutation approaches:

    • Conservative substitutions to test specific physicochemical properties

    • Introduction of thermolabile residues (e.g., replacing proline with glycine)

    • Charge-altering mutations in salt-bridge forming residues

  • Functional assessment protocol:

    • Compare activity across temperature gradients (25-70°C)

    • Measure stability under radiation exposure

    • Assess protein half-life and denaturation kinetics

  • Comparative analysis framework:

    • Create equivalent mutations in mesophilic homologs

    • Test chimeric proteins with domain swapping

    • Correlate with molecular dynamics simulations

This systematic mutagenesis approach can reveal specific adaptations that allow ATP synthase to function under extreme conditions in R. xylanophilus, similar to approaches used to study other extremophilic proteins .

What are the challenges in expressing functional recombinant atpB from extremophilic bacteria like R. xylanophilus?

Expressing functional recombinant atpB from R. xylanophilus presents several technical challenges that require specific methodological solutions:

  • Membrane protein solubility issues:

    • Challenge: Hydrophobic transmembrane domains prone to aggregation

    • Solution: Fusion tags (MBP, SUMO) can enhance solubility; screening multiple detergents is essential

  • Functional folding in mesophilic expression hosts:

    • Challenge: E. coli may lack chaperones needed for proper folding of thermophilic proteins

    • Solution: Co-expression with chaperones or expression at elevated temperatures (30-37°C)

  • Post-translational modifications:

    • Challenge: Potential modifications in the native organism may be absent in E. coli

    • Solution: Consider eukaryotic expression systems if prokaryotic systems fail

  • Assembly with other ATP synthase components:

    • Challenge: The a-subunit functions as part of a complex, not in isolation

    • Solution: Co-expression with other F0 subunits may improve stability and functionality

  • Functional assessment limitations:

    • Challenge: Difficult to verify if the recombinant protein retains native function

    • Solution: Develop robust assays for proton translocation or reconstitute with other ATP synthase components

These challenges align with difficulties reported in the expression of other membrane proteins from extremophilic organisms, requiring careful optimization of expression and purification protocols .

How does the evolutionary context of Rubrobacterales inform research on R. xylanophilus atpB?

The evolutionary context of Rubrobacterales provides important insights for research on R. xylanophilus atpB:

  • Phylogenetic positioning:
    Rubrobacterales represents one of the deepest branching lineages within Actinobacteria . This ancient evolutionary history means that R. xylanophilus atpB may possess ancestral features of ATP synthases that have been modified in more recently evolved bacteria.

  • Environmental adaptations:
    Members of Rubrobacterales have been identified in extreme environments including hot springs, the Atacama Desert, and marine sediments . These diverse habitats suggest that atpB has evolved to function across varying extreme conditions.

  • Comparative genomic context:
    The genome of R. xylanophilus contains unique adaptations, as evidenced by its diverse trehalose synthesis pathways, some with eukaryotic affinities . Similar evolutionary novelty may exist in its ATP synthase genes.

  • Methodological implications for research:

    Research ApproachEvolutionary ConsiderationMethodological Implementation
    Sequence analysisAncient lineage positionInclude diverse outgroups from Bacteria and Archaea
    Structural studiesPotential ancestral featuresCompare with both bacterial and archaeal ATP synthases
    Functional assaysAdaptation to multiple stressorsTest function under combined stress conditions
    Expression systemsCodon usage divergenceConsider codon optimization for expression hosts

Recent studies have developed specific tools for detecting and isolating Rubrobacterales from environmental samples , which may facilitate collection of additional ATP synthase sequences for comparative analysis.

What controls should be included when studying recombinant R. xylanophilus atpB function?

When studying recombinant R. xylanophilus atpB function, a comprehensive set of controls is essential:

  • Positive controls:

    • Recombinant atpB from model organisms (E. coli, Bacillus PS3) with well-characterized function

    • Native ATP synthase complex from R. xylanophilus (if available)

    • Synthetic proteoliposomes with known proton permeability

  • Negative controls:

    • Inactive mutant versions (e.g., key proton channel residues mutated)

    • Empty vector expressions processed identically

    • Proteoliposomes without protein incorporation

  • Experimental validity controls:

    • Temperature controls: Function at both optimal (50-60°C) and non-optimal (25°C) temperatures

    • pH controls: Activity across pH range to verify specific activity

    • Inhibition controls: Specific ATP synthase inhibitors (oligomycin, DCCD)

  • Technical controls:

    • Expression tag-only proteins to verify tag effects

    • Membrane protein of similar size/complexity as expression control

    • Detergent-only samples for background in functional assays

This systematic control approach ensures that observed functional properties are specifically attributable to R. xylanophilus atpB and not experimental artifacts or contamination.

How can researchers optimize purification protocols for recombinant R. xylanophilus atpB?

Optimizing purification of recombinant R. xylanophilus atpB requires a systematic approach addressing the unique challenges of membrane protein purification from an extremophilic source:

  • Solubilization optimization:

    Detergent ClassExamplesOptimal ConcentrationAdvantages
    Mild non-ionicDDM, LMNG1-2% for extraction, 0.05-0.1% for purificationPreserves native structure
    ZwitterionicLDAO, Fos-choline1-2%Effective solubilization
    Newer amphipathicSMA copolymers2.5%Extracts native lipid environment
  • Chromatography strategy:

    • Initial capture: IMAC (Ni-NTA) for His-tagged protein

    • Intermediate purification: Ion exchange chromatography (IEX)

    • Polishing: Size exclusion chromatography (SEC)

  • Buffer optimization considerations:

    • Include stabilizing agents: glycerol (10-20%), specific lipids

    • Temperature selection: Consider performing purification at elevated temperatures (30-37°C) to maintain thermophilic protein stability

    • pH selection: Test range 6.5-8.0 to determine optimal stability

  • Quality assessment milestones:

    • SDS-PAGE and Western blot at each purification stage

    • Circular dichroism to confirm secondary structure

    • Dynamic light scattering to assess aggregation state

    • Thermal shift assays to verify protein stability

This methodological approach has been successful for other membrane proteins from extremophiles and can be adapted specifically for R. xylanophilus atpB .

What methods can be used to assess the thermal stability of recombinant R. xylanophilus atpB?

Assessing thermal stability of recombinant R. xylanophilus atpB requires multiple complementary approaches:

  • Spectroscopic methods:

    • Differential scanning calorimetry (DSC): Measures heat capacity changes during protein unfolding

    • Circular dichroism (CD) thermal melts: Monitors secondary structure changes with temperature

    • Intrinsic tryptophan fluorescence: Detects tertiary structure alterations during thermal denaturation

  • Functional stability assays:

    • Activity retention: Measure function after incubation at various temperatures

    • Thermal inactivation kinetics: Determine half-life at different temperatures

    • Recovery after thermal stress: Assess refolding capability

  • Physical stability assessments:

    • Dynamic light scattering (DLS): Monitor aggregation onset with increasing temperature

    • Thermal shift assays (TSA): Using environmentally sensitive dyes like SYPRO Orange

    • Size exclusion chromatography (SEC): Analyze oligomeric state changes with temperature

  • Molecular dynamics approaches:

    • In silico simulations: Predict conformational stability at different temperatures

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify flexible/rigid regions at different temperatures

Given R. xylanophilus's thermophilic nature, comparative analysis should include parallel testing of mesophilic homologs to highlight adaptations specific to this extremophile .

How can researchers investigate the interaction between R. xylanophilus atpB and other ATP synthase subunits?

Investigating interactions between R. xylanophilus atpB and other ATP synthase subunits requires a multi-faceted approach:

  • Co-purification strategies:

    • Co-expression: Design constructs to express multiple subunits simultaneously

    • Pull-down assays: Use tagged atpB to identify interacting partners

    • Native complex isolation: Extract intact ATP synthase from R. xylanophilus

  • Biophysical interaction analysis:

    • Surface plasmon resonance (SPR): Quantify binding kinetics and affinities

    • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters of binding

    • Microscale thermophoresis (MST): Measure interactions in solution with minimal protein consumption

  • Structural approaches:

    • Cross-linking coupled with mass spectrometry (XL-MS): Identify specific interaction sites

    • Cryo-electron microscopy: Visualize assembled complexes

    • Computational modeling: Predict interaction interfaces based on homology models

  • Functional validation:

    • Reconstitution studies: Assemble purified components and measure ATP synthesis

    • Mutagenesis: Modify predicted interaction sites and assess impact

    • Complementation assays: Test if R. xylanophilus atpB can function with components from other species

These approaches would be particularly valuable for understanding how R. xylanophilus ATP synthase maintains functional integrity under extreme conditions, potentially revealing adaptations not present in mesophilic homologs .

How should researchers interpret differences in activity between recombinant and native R. xylanophilus atpB?

Interpreting activity differences between recombinant and native R. xylanophilus atpB requires systematic analysis of multiple factors:

  • Expression system effects:

    • Recombinant protein may lack post-translational modifications present in native form

    • Codon usage differences between R. xylanophilus and expression host can affect protein folding

    • E. coli-expressed protein may lack specific lipid interactions required for optimal function

  • Structural integrity assessment:

    • Compare secondary structure content using circular dichroism

    • Analyze thermal stability profiles of both forms

    • Examine oligomeric state using native PAGE or size exclusion chromatography

  • Functional context considerations:

    • Native atpB functions within a complete ATP synthase complex

    • Recombinant protein may be studied in isolation or in reconstituted systems

    • Differences in lipid environment between native membrane and reconstituted systems

  • Methodological approach to reconcile differences:

    Observed DifferencePotential CauseInvestigation Method
    Lower activity in recombinantImproper foldingCD spectroscopy comparison
    Different thermal stabilityMissing stabilizing interactionsThermal shift assays with varied conditions
    Altered substrate specificityConformational differencesDetailed kinetic analysis
    Poor reconstitution efficiencyImproper orientation in membraneAccessibility assays with membrane-impermeable reagents

This methodological framework has been successfully applied to other extremophilic proteins, including those from R. xylanophilus, such as its trehalose synthesis enzymes .

What bioinformatic approaches can identify key functional residues in R. xylanophilus atpB?

Multiple bioinformatic approaches can effectively identify key functional residues in R. xylanophilus atpB:

  • Sequence-based analyses:

    • Multiple sequence alignment (MSA): Identify conserved residues across ATP synthase a-subunits

    • Conservation scoring: Calculate position-specific conservation using methods like ConSurf

    • Coevolution analysis: Detect co-evolving residue pairs using mutual information or direct coupling analysis

    • Evolutionary trace: Identify class-specific residues that distinguish thermophilic from mesophilic homologs

  • Structure-based approaches:

    • Homology modeling: Generate 3D structure based on related ATP synthase structures

    • Molecular dynamics: Simulate protein behavior to identify critical interaction networks

    • Electrostatic surface mapping: Identify potential proton pathways

    • Normal mode analysis: Predict functionally important flexible regions

  • Integrated methodologies:

    • Sequence-structure mapping: Project conservation onto 3D structure

    • Energy calculations: Identify residues contributing to thermostability

    • Network analysis: Calculate residue interaction networks to find communication pathways

  • Machine learning applications:

    • Feature extraction: Identify patterns associated with extremophilic adaptations

    • Classifier training: Develop models to predict functional residues

    • Deep learning: Apply neural networks to predict function from sequence

These approaches can be particularly valuable for identifying residues that contribute to R. xylanophilus atpB's function under extreme conditions, similar to analyses performed for other proteins from this organism .

How can researchers distinguish between adaptation features and phylogenetic signals in R. xylanophilus atpB?

Distinguishing between adaptive features and phylogenetic signals in R. xylanophilus atpB requires sophisticated analytical approaches:

  • Comparative phylogenetic methods:

    • Ancestral sequence reconstruction: Infer ancestral states to identify derived adaptive changes

    • Rate-shift analysis: Detect lineage-specific acceleration or deceleration of evolutionary rates

    • Selection tests: Apply tests for positive selection (dN/dS ratio) on specific branches or sites

    • Phylogenetic independent contrasts: Control for shared ancestry when correlating sequence features with phenotypes

  • Structure-function correlation:

    • Thermostability predictors: Compare predictions with actual stability measurements

    • Homology-based functional annotation: Map conserved sites across diverse lineages

    • Protein contact prediction: Identify compensatory mutations maintaining structure

  • Experimental validation approaches:

    • Horizontal gene transfer detection: Identify potential gene acquisitions from other extremophiles

    • Chimeric protein construction: Swap domains between R. xylanophilus and mesophilic homologs

    • Site-directed mutagenesis: Revert putative adaptive sites to ancestral states

  • Integrated analysis framework:

    Analysis LevelMethodOutputInterpretation
    SequenceBranch-site modelsSites under positive selectionPotential adaptive sites
    StructureΔΔG stability calculationEnergy contributionThermostability determinants
    PhysiologicalGrowth assays with mutantsFitness effectsFunctional significance
    EnvironmentalCorrelation with habitat parametersEnvironmental associationsAdaptive context

This methodological framework has been applied to other proteins from ancient bacterial lineages like Rubrobacterales, helping distinguish truly adaptive features from phylogenetic background .

How can R. xylanophilus atpB contribute to understanding ATP synthase adaptation to extreme environments?

R. xylanophilus atpB represents a valuable model for understanding ATP synthase adaptation to extreme environments through several research applications:

  • Comparative structural biology approaches:

    • Comparing structures of ATP synthases from thermophilic, mesophilic, and psychrophilic organisms

    • Identifying structural features that maintain membrane integrity at high temperatures

    • Examining ion channel properties that function under extreme conditions

  • Molecular adaptation mechanisms:

    • Investigating how proton translocation remains efficient at high temperatures

    • Identifying specific amino acid substitutions that enhance thermostability

    • Understanding interface adaptations between subunits that maintain assembly under stress

  • Evolutionary insights:

    • Studying R. xylanophilus atpB as a representative of an ancient bacterial lineage

    • Tracing the evolution of thermophilic adaptations in ATP synthase

    • Identifying convergent evolution patterns in distantly related extremophiles

  • Experimental applications:

    • Using thermostable features as design principles for engineered proteins

    • Developing reconstitution systems that function across wide temperature ranges

    • Creating chimeric ATP synthases with enhanced stability properties

R. xylanophilus's multiple stress resistances (thermophilic, radiation-resistant, desiccation-resistant) make its ATP synthase particularly valuable for understanding how essential membrane complexes maintain function under combined stresses, a perspective not available from studying single-stress adapted organisms.

What potential biotechnological applications exist for recombinant R. xylanophilus atpB?

Recombinant R. xylanophilus atpB offers several promising biotechnological applications based on its extremophilic properties:

  • Bioenergetic applications:

    • Thermostable ATP production systems: Developing heat-resistant bioelectrochemical cells

    • Proton gradient devices: Creating sensors or energy conversion systems functional at high temperatures

    • Membrane protein engineering: Using thermostable domains for chimeric protein design

  • Structural biology tools:

    • Thermostable membrane protein scaffolds: For stabilizing other membrane proteins

    • Crystallization chaperones: Aiding structure determination of challenging membrane proteins

    • Model systems: For studying proton translocation mechanisms under extreme conditions

  • Nanobiotechnology applications:

    • Proteoliposome stability enhancement: Improving membrane integrity at elevated temperatures

    • Biosensor development: Creating detection systems with enhanced environmental tolerance

    • Nanoreactor design: Encapsulating reaction components in thermostable membranes

  • Methodological innovations:

    ApplicationTechnical ApproachAdvantage over Current Methods
    Protein purification aidsThermostable affinity tagsHeat treatment as purification step
    Membrane protein expressionExpression enhancersImproved yield of difficult targets
    Bioenergetic devicesHeat-resistant proton channelsFunction under extreme conditions
    Stress-resistant bioprocessesEngineered membrane componentsExtended operational parameters

These applications leverage the natural adaptations of R. xylanophilus proteins to extreme conditions, potentially enabling biotechnological processes to operate under broader environmental conditions .

How can isotopic labeling of recombinant R. xylanophilus atpB facilitate structural studies?

Isotopic labeling of recombinant R. xylanophilus atpB provides powerful approaches for structural studies:

These approaches are particularly valuable for membrane proteins like atpB, where traditional structural biology techniques face significant challenges, and have been successfully applied to other challenging membrane proteins from extremophiles .

How can functional assays for R. xylanophilus atpB be adapted to reflect its native extreme environment?

Adapting functional assays for R. xylanophilus atpB to reflect its native extreme environment requires specialized methodological approaches:

  • Temperature adaptations:

    • High-temperature assay buffers: Use buffers with high boiling points (CAPS, phosphate)

    • Thermostable coupling enzymes: Replace mesophilic enzymes in coupled assays

    • Temperature-controlled reaction vessels: Use jacketed cuvettes or thermocyclers

    • Real-time monitoring: Implement continuous measurement to capture rapid kinetics at high temperatures

  • Radiation resistance testing:

    • Pre-exposure protocols: Subject protein to controlled radiation doses before activity testing

    • In situ irradiation: Measure activity changes during radiation exposure

    • Recovery assessment: Monitor function restoration after radiation stress

  • Desiccation resistance approaches:

    • Controlled dehydration: Subject protein to defined water activity levels

    • Activity in low-water systems: Adapt assays to organic solvents or ionic liquids

    • Rehydration kinetics: Measure functional recovery upon rehydration

  • Combined stress methodology:

    Stress CombinationAssay DesignMeasurement Approach
    Heat + saltThermostable high-salt bufferspH-sensitive dyes for proton translocation
    Radiation + heatIrradiation at elevated temperaturesOxygen consumption or ATP synthesis rates
    Desiccation + radiationControlled water activity with radiation exposureActivity recovery after stress removal
    All three stressesSequential or simultaneous applicationStructural integrity and functional measurements

These methodologically sophisticated approaches would more accurately represent the environmental conditions under which R. xylanophilus naturally functions and provide insights into the molecular basis of its exceptional stress resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.