Recombinant Rubrobacter xylanophilus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant nuoK is synthesized using heterologous expression systems:

Expression Systems Comparison

SystemYieldAdvantagesSource
E. coliHighCost-effective, rapid production
YeastMediumPost-translational modifications
BaculovirusLowEukaryotic folding environment

The protein is typically purified via affinity chromatography (His-tag) and lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) . Reconstitution requires deionized water (0.1–1.0 mg/mL) and glycerol (5–50%) for stability .

Functional Role in Electron Transport

nuoK is a core subunit of NADH-quinone oxidoreductase (Complex I), which catalyzes electron transfer from NADH to quinone, coupled with proton translocation. Key mechanistic insights include:

  • Electron Transfer Pathway: Electrons move from NADH → FAD → [2Fe–2S] clusters → quinone .

  • Sodium Translocation: Homology models suggest nuoK in Rubrobacter may facilitate Na+ transport, analogous to Vibrio cholerae NQR .

  • Conformational Flexibility: Structural shifts in subunits (e.g., NqrF, NqrC) enable redox-driven pumping .

Research Applications

  • Enzyme Kinetics: Study electron transfer rates and inhibitor effects.

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve conformational states .

  • Industrial Biotechnology: Potential use in bioenergetic engineering for synthetic pathways.

Comparative Analysis with Homologs

The Anaeromyxobacter dehalogenans nuoK (UniProt Q2IHA4) shares 37% sequence identity with Rubrobacter nuoK but lacks key residues for Na+ binding, suggesting functional divergence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Rxyl_1628; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)
Target Names
nuoK
Target Protein Sequence
MQQLVEQLNAQIPLEGYLTVAAIMFAIGAWGALIRRNAVVVFMCVELMINAVNLTLVAFA DFLPGAGGAGAGYTVLIIAIAAAEVAVGLAIVLAIFRTRRTVNIDEVDSLRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be menaquinone. The enzyme couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rubrobacter xylanophilus and why is it significant for research?

Rubrobacter xylanophilus is a thermophilic species of bacteria belonging to the phylum Actinomycetota (Actinobacteria) . It is significant in research for several unique characteristics: it is the only known true radiation-resistant thermophile, exhibiting extreme gamma-radiation resistance with a higher shoulder dose than the canonical radiation-resistant Deinococcus species . The organism is slightly halotolerant, Gram-positive, and appears as short rods or cocci under microscopy . Rubrobacter xylanophilus is also notable for its ability to degrade complex polysaccharides like xylan and hemicellulose, suggesting potential biotechnological applications . Various strains have been isolated from different environments, including the well-studied strain AA3-22 from Arima Onsen (hot spring) in Japan, which grows optimally at 58°C with a doubling time of 13 hours .

What is the NADH-quinone oxidoreductase subunit K (nuoK) and what is its role?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH dehydrogenase I complex, which is part of the electron transport chain in bacterial respiration . This protein is involved in the transfer of electrons from NADH to quinones in the respiratory chain, contributing to energy production in the cell . The nuoK subunit is relatively small (112 amino acids in R. xylanophilus) and is membrane-associated, containing primarily hydrophobic residues that form transmembrane helices . This protein plays a critical role in maintaining the structural integrity and functional efficiency of the respiratory complex.

What is known about the genome and proteome context of nuoK in R. xylanophilus?

The complete genome of Rubrobacter xylanophilus has been sequenced, with strain AA3-22 having a circular chromosome of 3,022,875 bp with a high G+C content of 68.8% . The genome contains 3,070 coding sequences along with three rRNA genes and 49 tRNA genes . The nuoK gene is part of the operon encoding the NADH:quinone oxidoreductase complex (complex I), which typically consists of 14 subunits in bacteria. Phylogenetic analysis of respiratory chain components from R. xylanophilus has shown interesting evolutionary relationships, with some components showing significant homology (60-94%) to those from bacteria of the Deinococcus-Thermus phylum, suggesting possible horizontal gene transfer events or shared evolutionary history related to their similar extreme resistance phenotypes .

What are the optimal conditions for expressing recombinant R. xylanophilus nuoK protein?

For optimal expression of recombinant R. xylanophilus nuoK protein, the following protocol has been established based on current research:

  • Expression System: E. coli is the preferred heterologous host for expression .

  • Vector Design: The coding sequence should be cloned into an expression vector with an N-terminal His-tag to facilitate purification .

  • Induction Conditions: Optimal expression is typically achieved using 0.5-1.0 mM IPTG when cultures reach OD600 of 0.6-0.8.

  • Growth Temperature: After induction, growth at 30°C rather than 37°C helps improve proper folding of the membrane protein.

  • Expression Duration: 4-6 hours post-induction is typically sufficient for good protein yields.

  • Lysis Conditions: Cell disruption should be performed in the presence of mild detergents (0.5-1% n-dodecyl β-D-maltoside) to solubilize the membrane protein.

The expressed protein can be purified using nickel affinity chromatography and typically yields greater than 90% purity as determined by SDS-PAGE .

What experimental approaches are used to study the function of nuoK in electron transport chains?

Several methodological approaches are employed to study nuoK's function:

  • Site-Directed Mutagenesis: Key residues are mutated to analyze their roles in protein function, similar to approaches used with other respiratory complex subunits .

  • Heterodimer Expression: Following methodologies similar to those used for other oxidoreductases, heterodimers containing wild-type and mutant subunits can be created to study subunit interactions and functional dependencies .

  • Enzyme Kinetics Analysis: Purified protein or reconstituted complexes are assessed for enzymatic activity using:

    • NADH oxidation assays (monitoring absorbance at 340 nm)

    • Artificial electron acceptors such as menadione or dichloroindophenol

    • Oxygen consumption measurements using oxygen electrodes

  • Reconstitution in Liposomes: The protein can be incorporated into artificial membrane systems to study proton pumping and electron transfer in isolation.

  • Protein-Protein Interaction Studies: Techniques such as crosslinking, co-immunoprecipitation, and FRET are used to study interactions with other subunits of the respiratory complex.

How should researchers design experiments to study nuoK function in the context of thermophilic adaptations?

When designing experiments to investigate nuoK's role in thermophilic adaptations, researchers should consider the following methodological approaches:

  • Temperature-Dependent Activity Assays: Conduct enzymatic assays across a temperature gradient (20-80°C) to determine optimal temperature and thermal stability profiles .

  • Comparative Analysis: Design experiments that directly compare R. xylanophilus nuoK with homologs from mesophilic bacteria under identical conditions to identify thermostability determinants.

  • Structural Stability Assays: Employ circular dichroism (CD) spectroscopy and differential scanning calorimetry (DSC) at various temperatures to assess structural integrity and unfolding temperatures.

  • Chimeric Protein Construction: Create fusion proteins combining domains from thermophilic and mesophilic homologs to identify specific regions responsible for thermostability.

  • Controlled Variable Design: Following proper experimental design principles, researchers should:

    • Clearly define independent variables (temperature, pH, salt concentration) and dependent variables (activity, stability)

    • Include appropriate controls for each experimental condition

    • Ensure sufficient replication and randomization

    • Control for confounding variables such as protein concentration and buffer composition

  • In vivo Complementation Studies: Test functionality by expressing the protein in mesophilic hosts under thermal stress conditions.

How can structural insights from R. xylanophilus nuoK contribute to engineering thermostable respiratory complexes?

The structural features of R. xylanophilus nuoK that confer thermostability can serve as a blueprint for engineering thermostable respiratory complexes with enhanced industrial applications. Researchers can:

  • Identify Thermostability Determinants: Conduct comparative structural analysis between thermophilic and mesophilic nuoK proteins to identify specific amino acid substitutions, salt bridges, and hydrophobic interactions that contribute to thermostability.

  • Apply Rational Design Approaches: Use site-directed mutagenesis to introduce thermostabilizing features identified in R. xylanophilus nuoK into mesophilic homologs.

  • Employ Directed Evolution: Develop high-throughput screening methods to select for thermostable variants of respiratory complex subunits.

  • Utilize Computational Modeling: Apply molecular dynamics simulations to predict the effects of mutations on protein stability at elevated temperatures.

  • Develop Chimeric Proteins: Create fusion proteins combining the most thermostable regions from various extremophilic organisms to generate novel enzymes with enhanced thermal properties.

These approaches can lead to the development of biocatalysts with improved stability for biotechnological applications such as biofuel cells, bioremediation processes, and industrial biocatalysis at elevated temperatures.

What is the relationship between radiation resistance and the function of respiratory chain components like nuoK in R. xylanophilus?

The relationship between radiation resistance and respiratory chain components in R. xylanophilus represents a complex and fascinating research area:

  • Oxidative Stress Management: NADH-quinone oxidoreductase complexes are known to be major sources of reactive oxygen species (ROS) in cells. In R. xylanophilus, the nuoK and other respiratory complex components may have evolved specialized mechanisms to minimize ROS production, which would be advantageous for radiation resistance .

  • Membrane Integrity Maintenance: The extreme radiation resistance of R. xylanophilus suggests its membrane integrity is maintained even under severe stress conditions . The nuoK protein, being membrane-embedded, likely contributes to this stability through specialized structural features.

  • Energy Metabolism During Recovery: Following radiation exposure, efficient energy generation is crucial for DNA repair and cellular recovery. The NADH-quinone oxidoreductase complex, including nuoK, may be optimized to maintain functionality post-irradiation.

  • Evolutionary Connections: Phylogenetic analysis has shown some respiratory chain components in R. xylanophilus share homology with those from Deinococcus-Thermus phylum bacteria , which are also known for radiation resistance, suggesting possible evolutionary adaptations in these components related to extremophilic lifestyles.

  • Research Approaches: To investigate these relationships, researchers should design experiments that:

    • Measure respiratory chain function before and after radiation exposure

    • Compare the radiation sensitivity of mutants with alterations in respiratory components

    • Analyze ROS production in wild-type versus respiratory chain mutants

    • Examine membrane integrity in relation to respiratory complex structure

How can comparative genomic and proteomic analyses of nuoK across extremophiles inform our understanding of adaptation mechanisms?

Comparative genomic and proteomic analyses of nuoK across different extremophiles provide valuable insights into adaptation mechanisms:

  • Sequence Conservation Analysis: Identification of highly conserved residues across phylogenetically diverse extremophiles suggests functionally critical regions, while variable regions may indicate adaptations to specific environmental conditions.

  • Synteny Analysis: Examination of gene neighborhood conservation across extremophiles can reveal co-evolution of functionally related genes and potential horizontal gene transfer events.

  • Evolutionary Rate Analysis: Calculation of dN/dS ratios (non-synonymous to synonymous substitution rates) can identify sites under positive selection that may contribute to environmental adaptations.

  • Structural Bioinformatics Approaches: Homology modeling and structural alignment of nuoK proteins from different extremophiles can reveal common structural adaptations to extreme conditions.

  • Methodological Considerations:

    • Use multiple sequence alignment methods specifically optimized for membrane proteins

    • Employ phylogenetic reconstruction methods that account for compositional biases in extremophilic genomes

    • Consider the genomic context and potential operon structures

    • Integrate transcriptomic data to assess expression patterns under stress conditions

Such comparative analyses can identify convergent evolution patterns across different extremophiles and provide insights into the molecular basis of adaptation to extreme environments.

What are common challenges in working with recombinant nuoK protein and how can they be addressed?

Working with membrane proteins like nuoK presents several technical challenges:

ChallengeCauseSolution
Low expression yieldsMembrane protein toxicity to host cellsUse tightly controlled induction systems; lower induction temperature to 20-25°C; use specialized E. coli strains (C41/C43)
Protein aggregationImproper folding; hydrophobic interactionsInclude detergents during purification (0.5-1% DDM or LDAO); optimize solubilization conditions; use fusion partners (MBP, SUMO)
Loss of activityDenaturation during purificationMaintain proper detergent concentrations throughout purification; avoid freeze-thaw cycles; include stabilizing agents (glycerol 10-15%)
Poor solubilityHydrophobic nature of membrane proteinsScreen multiple detergents; consider nanodiscs or amphipols for stabilization
Difficult reconstitutionComplex assembly requirementsCo-express with partner subunits; use gentle reconstitution methods with gradual detergent removal
Inactive proteinLoss of cofactors or proper structureInclude potential cofactors during purification; verify proper folding with CD spectroscopy

Researchers should implement quality control steps throughout the purification process, including activity assays and structural integrity verification to ensure the isolated protein maintains native-like properties .

How can researchers effectively study protein-protein interactions involving nuoK within the respiratory complex?

To effectively study protein-protein interactions involving nuoK within the respiratory complex, researchers should consider these methodological approaches:

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can identify neighboring subunits and specific interaction sites within the complex.

  • Co-purification Approaches:

    • Pull-down assays using tagged nuoK to identify interaction partners

    • Tandem affinity purification to isolate intact complexes

    • Blue native PAGE to preserve native protein-protein interactions

  • FRET/BRET Analysis: Fluorescence or bioluminescence resonance energy transfer can detect interactions between labeled subunits in reconstituted systems or in vivo.

  • Heterodimer Expression Systems: Similar to those used in NAD(P)H:quinone oxidoreductase studies, expressing tagged wild-type subunits alongside mutant versions can help elucidate subunit dependencies .

  • Subunit Swapping Experiments: Replace nuoK with homologs from different species to identify species-specific interaction determinants.

  • Computational Approaches: Molecular docking and molecular dynamics simulations can predict interaction interfaces and binding energies.

  • Cryo-EM Analysis: Single-particle cryo-electron microscopy can resolve the structure of the entire respiratory complex, revealing the precise position and interactions of nuoK.

These approaches should be used in combination to develop a comprehensive understanding of nuoK's interactions within the respiratory complex.

What considerations are important when designing experiments to compare nuoK function across different bacterial species?

When designing comparative studies of nuoK function across bacterial species, researchers should consider:

  • Standardized Expression Systems:

    • Use identical expression vectors, tags, and host strains

    • Normalize protein concentrations carefully

    • Verify protein folding and integrity across all samples

  • Physiological Relevance:

    • Consider the native growth conditions of each species

    • Test function across relevant temperature ranges for each organism

    • Include appropriate buffers and salt concentrations

  • Experimental Design Rigor:

    • Employ factorial experimental designs to test multiple variables simultaneously

    • Include appropriate positive and negative controls for each species

    • Ensure sufficient biological and technical replicates

    • Randomize experimental order to minimize systematic bias

  • Phylogenetic Context:

    • Include species representing diverse phylogenetic lineages

    • Consider evolutionary relationships when interpreting functional differences

    • Normalize results based on evolutionary distance when appropriate

  • Functional Assay Selection:

    • Choose assays that work across temperature ranges

    • Ensure detergents and buffer components are compatible with all proteins

    • Consider using multiple complementary assays to verify results

  • Data Analysis Approaches:

    • Use appropriate statistical methods for comparative analyses

    • Account for temperature-dependent effects on reaction kinetics

    • Consider employing comparative modeling approaches

By addressing these methodological considerations, researchers can generate robust comparative data that illuminates the evolutionary adaptations of nuoK across different bacterial species and environmental niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.