Recombinant Rubrobacter xylanophilus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Background on Undecaprenyl-diphosphatase (UppP)

Undecaprenyl-diphosphatase (UppP) is a critical enzyme in bacterial cell wall biosynthesis, catalyzing the dephosphorylation of undecaprenyl pyrophosphate (UPP) to form undecaprenyl monophosphate (Und-P). This lipid carrier is essential for shuttling peptidoglycan and teichoic acid precursors across the cytoplasmic membrane .

Key Roles of UppP:

FunctionDescription
Cell Wall SynthesisRecycles UPP for lipid I/II formation, enabling peptidoglycan polymerization .
Antibiotic ResistanceBacitracin binds UPP, inhibiting UppP activity; overexpression of UppP homologs (e.g., BcrC) confers resistance .
Stress ResponseDepletion of UppP activates σᴍ-dependent stress pathways in Bacillus subtilis .

Recombinant UppP Proteins in Analogous Systems

While Rubrobacter xylanophilus UppP is not explicitly documented, recombinant UppP from Azospirillum brasilense (UniProt P39438) provides a functional template:

Recombinant UppP (Azospirillum brasilense) Specifications :

ParameterValue
SourceE. coli expression system
TagN-terminal His-tag
Protein LengthFull-length (1–187 aa)
Purity>90% (SDS-PAGE)
AA SequenceMLIDQYLDAALLGLIEGLTEFLPVSSTGHLIIFDTLLGFEGPPGKVFEVVIQLGAILAIC TVYFARLWKVVTGLKDDPGARHFAMAVILAFLPAMVLGAALHGVIKAVLFNPTVVSIALI LGGVAILMAERLVPAPRYHQIERFPAPLALKIGLCQCLALVPGVSRSGATILGSLLMGVD RRTAAEF
StorageLyophilized powder, -20°C/-80°C

Rubrobacter xylanophilus Biochemical and Extremophilic Traits

Though UppP data are absent, R. xylanophilus exhibits unique extremophilic adaptations:

Key Features of R. xylanophilus :

TraitDescription
ThermophilicityOptimal growth at 60°C; radiation-resistant .
OsmoregulationProduces mannosylglycerate (MG), a compatible solute, constitutively .
PHA ProductionAccumulates polyhydroxyalkanoates (PHA) via class I/III synthases, a potential biotechnological target .
Proton PumpContains a light-driven proton-pumping rhodopsin (RxR) with a λₘₐₓ of 541 nm .

Research Gaps and Future Directions

Unaddressed Questions:

  1. UppP Expression in R. xylanophilus: No evidence of UppP homologs in Rubrobacter genomes; potential reliance on alternative phosphatases (e.g., YodM) .

  2. Antibiotic Synergy: UppP inhibitors (e.g., tetramic acids) show efficacy against Gram-positives . Could R. xylanophilus UppP inform novel antibiotic strategies?

  3. Extremophile Stress Mechanisms: Links between UppP activity, cell wall integrity, and radiation resistance in Rubrobacter .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Rxyl_1243; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)
Target Names
uppP
Target Protein Sequence
MLELLQAVLLGAVQGLTEFLPVSSSGHLLLGQYFLGLDQDRFGLSFDVALHLGTLVAVVV FFRRDLLRMAGAFVRSLTRGRDLSEPDQRLAYLVLAATVPAALIGYLWEDFFETAVRSPW VVVFNLAFVGLLFLVAEAVGRKSRRAEKMGFAEAVGIGLAQAAALVPGVSRSGATITLGL LFGLRREEAARFSFLMSAPIIAGAGTLQLGEVLAEGMGAEQALMFAVGFLCSAVVGYLAI RFFISFVARYSLRAFAYYRFALAALVAALLLL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Undecaprenyl-diphosphatase (uppP) in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP, EC 3.6.1.27) catalyzes the critical dephosphorylation of undecaprenyl diphosphate (UPP) to produce undecaprenyl phosphate, an essential carrier lipid in peptidoglycan biosynthesis . This reaction represents a key recycling step in the peptidoglycan synthesis pathway, where the lipid carrier must be regenerated to continue the transport of peptidoglycan precursors across the cell membrane. The enzyme's function contributes to cell wall integrity and is implicated in mechanisms of resistance to certain antibiotics, particularly bacitracin, which targets the UPP substrate . Research methodologies focusing on this pathway often employ radiolabeled substrates or fluorescent analogs to track the conversion of UPP to undecaprenyl phosphate in reconstituted membrane systems.

What structural characteristics define R. xylanophilus uppP and how do they relate to its membrane association?

R. xylanophilus uppP is a multi-pass integral membrane protein with several transmembrane domains that anchor it within the cell membrane . Analysis of its 272-amino acid sequence reveals hydrophobic regions consistent with membrane-spanning helices. The protein contains characteristic sequence motifs found in the undecaprenyl pyrophosphate phosphatase family, including conserved catalytic residues that coordinate with the phosphate groups of the substrate. For experimental structure-function studies, researchers typically employ site-directed mutagenesis of predicted catalytic residues followed by activity assays to determine their importance. Membrane topology analysis using techniques such as cysteine accessibility methods or GFP-fusion proteins can help determine the orientation of protein domains relative to the membrane.

How does the thermostability of R. xylanophilus proteins compare to mesophilic homologs?

Proteins from R. xylanophilus, including uppP, typically exhibit remarkable thermostability reflective of the organism's thermophilic nature. Similar to other R. xylanophilus proteins like the rhodopsin described in the literature, uppP is expected to maintain structural integrity at elevated temperatures . While specific thermal stability data for uppP is not directly provided in the search results, other proteins from this organism have shown extreme thermal stability compared to mesophilic counterparts. For example, the rhodopsin from R. xylanophilus demonstrated 16-times greater thermal stability than thermophilic rhodopsin TR and 4-times greater than bacteriorhodopsin from Halobacterium salinarum . Researchers investigating thermal properties typically employ differential scanning calorimetry, circular dichroism temperature scans, and activity assays performed after heat treatment to quantify thermostability.

What expression systems are optimal for producing functional recombinant R. xylanophilus uppP?

For laboratory-scale production of recombinant R. xylanophilus uppP, E. coli expression systems have been successfully employed . The search results indicate that in vitro E. coli expression systems with N-terminal His-tagging (typically 10xHis) provide effective production of the recombinant protein . When designing expression constructs, researchers should consider codon optimization for E. coli, as R. xylanophilus may have different codon usage patterns. For membrane proteins like uppP, specialized E. coli strains (such as C41(DE3) or C43(DE3)) that are adapted for membrane protein expression may yield better results than standard strains. Expression protocols typically involve induction with IPTG at reduced temperatures (16-20°C) to enhance proper folding of membrane proteins. Purification strategies involve solubilization with detergents followed by Ni-NTA affinity chromatography taking advantage of the His-tag .

What purification and solubilization strategies are most effective for maintaining uppP activity?

Purification of uppP presents challenges typical of integral membrane proteins. After expression in E. coli, cells are typically lysed and membrane fractions isolated by ultracentrifugation. The membrane fraction containing uppP is then solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin, which maintain the native structure and activity of membrane proteins. Following solubilization, the His-tagged protein can be purified using Ni-NTA affinity chromatography . For research applications requiring higher purity, additional chromatography steps such as size exclusion chromatography may be employed. Storage conditions are critical for maintaining activity - the recombinant protein can be stored in Tris-based buffers with 50% glycerol at -20°C to -80°C . Researchers should avoid repeated freeze-thaw cycles and may prepare working aliquots stored at 4°C for short-term use (up to one week) .

What analytical methods are suitable for assessing the enzymatic activity of purified uppP?

Several analytical approaches can be employed to assess uppP activity:

  • Phosphate release assay: The dephosphorylation of UPP releases inorganic phosphate, which can be quantified using colorimetric methods such as the malachite green assay or the more sensitive EnzChek Phosphate Assay.

  • HPLC analysis: Separation and quantification of the substrate (UPP) and product (undecaprenyl phosphate) using reverse-phase HPLC coupled with UV detection or mass spectrometry.

  • Radiolabeled substrate assay: Using 32P-labeled UPP to track the conversion to undecaprenyl phosphate, with products separated by thin-layer chromatography and quantified by autoradiography.

  • Coupled enzyme assays: Design of assay systems where the phosphate released is used by a coupling enzyme to generate a detectable signal.

For kinetic characterization, researchers typically determine the Km, Vmax, and kcat values by measuring initial reaction rates at varying substrate concentrations under optimized buffer conditions (pH, temperature, metal cofactors). Biochemical characterization should include assessment of pH optima, temperature stability, and effects of potential inhibitors.

How can structural studies of R. xylanophilus uppP inform antimicrobial drug development?

Structural studies of R. xylanophilus uppP can provide critical insights for antimicrobial drug development due to the enzyme's essential role in bacterial cell wall synthesis. While no crystal structure of uppP from R. xylanophilus is reported in the provided search results, researchers can employ several approaches to elucidate its structure:

  • X-ray crystallography: For membrane proteins, this typically involves crystallization in lipidic cubic phases or with the help of crystallization chaperones like antibody fragments.

  • Cryo-electron microscopy: Increasingly used for membrane proteins that resist crystallization.

  • Homology modeling: Based on related structures, potentially informed by the crystal structures of uppP homologs from other organisms.

The resulting structural information can reveal active site architecture, substrate binding pockets, and conformational states that are critical for catalysis. This knowledge can guide structure-based drug design approaches to develop inhibitors that specifically target bacterial uppP enzymes while sparing human homologs. Key research methodologies include molecular docking of potential inhibitors, molecular dynamics simulations to understand protein flexibility, and structure-activity relationship studies of designed inhibitor compounds. Enzyme inhibition assays would then be employed to validate computational predictions.

What approaches can be used to investigate the role of uppP in bacitracin resistance mechanisms?

UppP is known as a bacitracin resistance protein , suggesting its involvement in antibiotic resistance mechanisms. Research approaches to investigate this function include:

  • Gene knockout/knockdown studies: Creating uppP-deficient bacterial strains and assessing their sensitivity to bacitracin compared to wild-type strains.

  • Overexpression studies: Evaluating whether uppP overexpression confers increased bacitracin resistance.

  • Site-directed mutagenesis: Identifying key residues involved in the resistance mechanism through targeted mutations followed by phenotypic analysis.

  • Biochemical competition assays: Determining whether bacitracin directly interacts with uppP or competes with its natural substrate.

  • Comparative genomics and transcriptomics: Analyzing uppP expression levels in naturally bacitracin-resistant versus sensitive bacterial strains.

Researchers can employ minimum inhibitory concentration (MIC) assays with bacitracin in the presence or absence of uppP inhibitors to quantify the contribution of this enzyme to resistance. Time-kill kinetics and synergy studies may also reveal whether targeting uppP can potentiate the activity of bacitracin or other antibiotics that target cell wall synthesis.

What is known about the substrate specificity of R. xylanophilus uppP compared to homologs from other species?

  • Substrate analog studies: Testing the enzyme's activity with various undecaprenyl-based substrates with modifications to the chain length, phosphate groups, or isoprenoid structure.

  • Kinetic analysis: Determining kinetic parameters (Km, kcat, kcat/Km) for different potential substrates to assess relative efficiency.

  • Comparative genomics and phylogenetic analysis: Examining sequence conservation among uppP homologs and correlating sequence differences with known functional variations.

  • Structural modeling and docking: Predicting substrate interactions based on homology models or determined structures.

Drawing parallels from other R. xylanophilus enzymes, researchers might expect unique substrate preferences. For instance, the mannosyl-3-phosphoglycerate synthase from this organism shows dual substrate specificity, being able to utilize both GDP-mannose and GDP-glucose . Similar multifunctionality might be investigated for uppP through careful biochemical characterization with a panel of substrate analogs.

How does the biochemical behavior of R. xylanophilus uppP compare to uppP from mesophilic bacteria?

R. xylanophilus is a thermophilic bacterium, and its proteins typically exhibit adaptations for function at elevated temperatures. A comparative analysis between R. xylanophilus uppP and mesophilic counterparts would likely reveal differences in:

  • Thermal stability: R. xylanophilus uppP is expected to maintain activity at higher temperatures, similar to other proteins from this organism that show exceptional thermal stability .

  • pH optimum: The pH profile of enzyme activity might differ, potentially showing activity over a broader pH range or at extreme pH values.

  • Structural rigidity: Thermophilic proteins often display increased structural rigidity through additional salt bridges, disulfide bonds, and hydrophobic interactions.

  • Kinetic parameters: Thermophilic enzymes sometimes exhibit lower catalytic efficiency at lower temperatures but maintain activity at temperatures that would denature mesophilic homologs.

To compare these properties, researchers would conduct parallel biochemical characterization of uppP from R. xylanophilus and mesophilic bacteria under standardized conditions. Temperature-activity profiles, thermal inactivation kinetics, and structural stability assessments using techniques like circular dichroism spectroscopy would be particularly informative. Such comparative studies could reveal molecular adaptations that contribute to thermostability and might be transferable to other proteins through protein engineering.

What structural features contribute to the extreme thermostability of proteins from R. xylanophilus?

While specific data on uppP thermostability is not provided in the search results, insights can be drawn from other R. xylanophilus proteins. The rhodopsin from this organism exhibits exceptional thermal stability compared to other thermophilic and mesophilic proteins . Common structural features contributing to thermostability in proteins from thermophilic organisms include:

  • Increased number of salt bridges: Electrostatic interactions between charged amino acid side chains stabilize protein structure at high temperatures.

  • Enhanced hydrophobic core packing: Tighter packing of hydrophobic residues increases internal stability.

  • Reduced number of thermolabile residues: Fewer asparagine, glutamine, cysteine, and methionine residues that are prone to deamidation or oxidation at high temperatures.

  • Additional disulfide bonds: Covalent cross-links that enhance structural rigidity.

  • Shortened surface loops: Reducing flexible regions that are prone to unfolding at elevated temperatures.

What strategies can address poor expression yields of recombinant R. xylanophilus uppP?

Membrane proteins like uppP often present expression challenges. When faced with poor yields, researchers can implement several strategies:

  • Optimization of expression conditions:

    • Test different E. coli strains specifically designed for membrane protein expression (C41(DE3), C43(DE3), Lemo21(DE3))

    • Vary induction parameters (IPTG concentration, induction temperature, duration)

    • Screen different media compositions (TB, 2xYT, auto-induction media)

  • Construct modification:

    • Codon optimization for E. coli expression

    • Testing different fusion tags (SUMO, MBP, TrxA) that can enhance solubility

    • Creating truncated constructs that retain the catalytic domain but remove problematic regions

  • Co-expression strategies:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ) to assist folding

    • Co-express with proteins that interact with uppP in its native context

  • Alternative expression systems:

    • Cell-free expression systems specifically adapted for membrane proteins

    • Baculovirus-insect cell expression for complex membrane proteins

Each approach should be systematically evaluated through small-scale expression trials followed by Western blot analysis to detect the His-tagged protein before scaling up to preparative quantities.

How can researchers overcome challenges in functional characterization of membrane-bound enzymes like uppP?

Functional characterization of membrane proteins presents unique challenges. Researchers can address these through several approaches:

  • Detergent screening:

    • Systematically test different detergents (DDM, LMNG, CHAPS, digitonin) for their ability to solubilize uppP while maintaining activity

    • Consider detergent mixtures that may better mimic the native membrane environment

  • Reconstitution systems:

    • Incorporate purified uppP into liposomes or nanodiscs to provide a membrane-like environment

    • Test activity in these reconstituted systems which often better support native function

  • Substrate accessibility:

    • For assays, ensure the hydrophobic substrate can efficiently access the enzyme active site

    • Consider using substrate analogs with enhanced solubility for initial screening

  • Activity detection methods:

    • Develop sensitive assays capable of detecting low enzyme activity

    • Consider coupled enzyme assays where the product of the uppP reaction initiates a easily detectable secondary reaction

  • Control experiments:

    • Include proper negative controls (inactive mutants, heat-denatured enzyme)

    • Use known inhibitors of uppP as positive controls for assay validation

These methodological approaches should be adapted based on the specific research questions and available resources, with careful optimization of each step to ensure reliable and reproducible results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.