Recombinant Rusa unicolor Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Rusa unicolor (Sambar) (Cervus unicolor)
Target Names
Target Protein Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYVISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLNYFEKWSASML
Uniprot No.

Target Background

Function

Recombinant Rusa unicolor Cytochrome c oxidase subunit 2 (MT-CO2): Background Information

MT-CO2 is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, comprising heme a3 and copper B (CuB), reduces oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the general function of Cytochrome c Oxidase Subunit 2 in mitochondrial respiration?

Cytochrome c oxidase subunit 2 (COX2) functions as a vital component of the cytochrome c oxidase complex (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This complex catalyzes the reduction of oxygen to water while creating an electrochemical gradient across the inner mitochondrial membrane. Specifically, COX2 contains the dinuclear copper A center (CU(A)) that receives electrons from cytochrome c in the intermembrane space and transfers them to heme A in subunit 1, before they reach the binuclear center where oxygen reduction occurs . This process is essential for oxidative phosphorylation and efficient ATP production. The protein contains two transmembrane regions (positions 15-45 and 60-87) that anchor it within the inner mitochondrial membrane .

How does Rusa unicolor MT-CO2 differ structurally from other cervid species?

Rusa unicolor (sambar deer) MT-CO2 exhibits specific nucleotide composition patterns that distinguish it from other cervid species. While MT-CO2 is generally conserved due to its essential function, comparative genomic analyses reveal evolutionary divergences among different deer species. The nucleotide composition of mitochondrial genes, including COX2, shows evidence of both convergent evolution and ancestral polymorphism in the cervid family .

Analysis of nucleotide sequences suggests that Rusa unicolor's MT-CO2 maintains ancestral features that differentiate it from the genus Cervus, despite their close phylogenetic relationship. Interestingly, Rusa unicolor showed paraphyletic positioning relative to Cervus in mitochondrial DNA analyses, indicating potential historical introgression events involving mitochondrial genomes .

What expression systems are most suitable for recombinant Rusa unicolor MT-CO2?

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, economical, rapid growthMembrane protein folding challenges, lack of post-translational modificationsUse of specialized strains (C41/C43), fusion tags (MBP, SUMO), lower induction temperature (16-25°C)
Yeast (P. pastoris)Proper folding environment, post-translational modificationsLonger expression time, lower yieldCodon optimization, constitutive promoters for stable expression
Insect cell (Sf9, Hi5)Native-like membrane environment, proper foldingHigher cost, technical complexityBaculovirus optimization, supplemental copper during expression
Mammalian (HEK293, CHO)Most native-like environment, complete modificationsHighest cost, lowest yieldStable cell line development, nutrient optimization

When expressing recombinant Rusa unicolor MT-CO2, researchers should consider that as a membrane protein with copper-binding sites, it requires specialized handling. Mammalian expression systems most closely mimic the native environment, though at higher cost. Insect cell systems offer a practical balance between authenticity and yield for most research applications .

What challenges exist in expressing functional recombinant MT-CO2, and how can they be addressed?

Expressing functional recombinant MT-CO2 presents several significant challenges:

  • Membrane protein solubility: MT-CO2 contains two transmembrane domains (positions 15-45 and 60-87) that make it inherently hydrophobic . Strategies to improve solubility include:

    • Using specialized detergents (DDM, LMNG, digitonin)

    • Employing amphipols or nanodiscs for stabilization

    • Incorporating solubility-enhancing fusion partners

  • Copper ion incorporation: The protein's functionality depends on proper copper ion binding . Researchers can achieve this through:

    • Supplementing expression media with copper compounds

    • Implementing post-purification copper reconstitution protocols

    • Using specialized buffers containing copper chaperones

  • Preservation of native conformation: Maintaining the structural integrity during purification requires:

    • Gentle extraction procedures

    • Purification under reducing conditions

    • Temperature control throughout processing

These challenges necessitate a multifaceted approach combining optimized expression conditions, specialized purification techniques, and functional verification assays.

How can structural studies of recombinant Rusa unicolor MT-CO2 inform evolutionary relationships within Cervidae?

Structural studies of Rusa unicolor MT-CO2 provide valuable insights into evolutionary relationships within Cervidae, particularly regarding the conflicting phylogenetic signals observed between nuclear and mitochondrial genomes. The genus Rusa appears paraphyletic with respect to Cervus in mtDNA trees, suggesting potential ancestral polymorphisms or mitochondrial introgression between these lineages .

Detailed structural analysis of MT-CO2 can reveal:

  • Conserved functional domains: Identify regions under purifying selection that maintain essential respiratory functions across species

  • Species-specific adaptations: Detect amino acid substitutions unique to Rusa unicolor that may reflect environmental adaptations

  • Evidence of selection pressure: Analysis of MT-CO2 can reveal signs of positive selection, similar to what has been observed in other mitochondrial genes like ATP8 and COX1 in certain cervid species comparisons

Comparing the three-dimensional structure of Rusa unicolor MT-CO2 with homologs from other cervids can highlight structural variations that may have functional consequences and provide molecular evidence for evolutionary relationships not apparent from sequence data alone.

What evidence exists for interspecific gene exchange involving Rusa unicolor mitochondrial genes?

Phylogenetic analyses reveal complex evolutionary patterns suggesting possible interspecific gene exchange involving Rusa unicolor. Nuclear genome studies have indicated a high probability of gene exchange between Rusa unicolor and several Cervus species, including C. albirostris and C. nippon . This evidence emerges from discordant phylogenetic patterns between nuclear and mitochondrial genomes.

The paraphyletic relationship of Rusa with respect to Cervus in mitochondrial DNA analyses suggests historical introgression events. Specifically, one hypothesis proposes mitochondrial introgression from the lineage of R. timorensis and R. unicolor to the common ancestor of Cervus or in the opposite direction . This scenario is supported by the close geographical proximity of these species, which increases the possibility of historical hybridization events.

  • Inconsistent positioning of Rusa species in different phylogenetic studies

  • Nucleotide composition similarities between certain genes across expected taxonomic boundaries

  • Decreased genetic distances (p-distances) between certain species pairs that should be more divergent

  • Conflicting topologies between nuclear and mitochondrial phylogenetic trees

These patterns of potential interspecific gene exchange provide a fascinating window into the complex evolutionary history of cervids and highlight the value of MT-CO2 as a marker for studying such phenomena.

What are optimal purification strategies for maintaining structural integrity of recombinant Rusa unicolor MT-CO2?

Purifying recombinant Rusa unicolor MT-CO2 while preserving its structural integrity requires specialized protocols due to its transmembrane domains and copper-binding requirements . A comprehensive purification strategy should include:

Initial Extraction Protocol:

  • Cell lysis using gentle detergents (DDM or LMNG at 1-2%)

  • Addition of protease inhibitors and reducing agents

  • Controlled sonication or mechanical disruption at 4°C

  • Centrifugation at 100,000×g to isolate membrane fractions

Affinity Purification Approach:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Copper-loaded affinity resins for functional selection

  • Gentle elution using imidazole gradients rather than step elutions

Further Purification Steps:

  • Size exclusion chromatography in detergent-containing buffers

  • Ion exchange chromatography at pH values preserving native conformation

  • Amphipol exchange for long-term stability studies

Throughout purification, maintain buffers containing 0.5-5 μM copper ions to preserve binding site integrity, and keep reducing agents present to prevent oxidative damage to cysteine residues critical for protein structure .

How can functional assays be optimized to measure recombinant Rusa unicolor MT-CO2 activity?

Functional assessment of recombinant Rusa unicolor MT-CO2 requires specialized assays that measure its native electron transfer capabilities. The following methodological approaches provide robust activity measurements:

Spectrophotometric Cytochrome c Oxidation Assay:

  • Prepare reduced cytochrome c using sodium dithionite or ascorbate

  • Monitor absorbance decrease at 550 nm as cytochrome c becomes oxidized

  • Calculate initial reaction rates under varying substrate concentrations

  • Derive kinetic parameters (Km, Vmax) for comparison with native enzyme

Oxygen Consumption Measurements:

  • Use Clark-type oxygen electrodes or optical oxygen sensors

  • Measure real-time oxygen consumption in reconstituted systems

  • Compare activity rates in the presence of various electron donors

Electron Transfer Kinetics:

  • Employ stopped-flow spectroscopy to measure rapid electron transfer events

  • Use rapid freeze-quench EPR to capture transient intermediates

  • Calculate electron transfer rates under physiological conditions

Each assay requires careful optimization of buffer conditions (pH 7.2-7.4), ionic strength (100-150 mM), temperature (30-37°C), and copper availability to accurately reflect the native activity of Rusa unicolor MT-CO2 .

What techniques can ensure proper copper incorporation in recombinant Rusa unicolor MT-CO2?

Ensuring proper copper incorporation is critical for functional recombinant MT-CO2, as the dinuclear copper A center (CU(A)) is essential for electron transfer from cytochrome c . The following methodology optimizes copper incorporation:

During Expression:

  • Supplement expression media with 10-50 μM CuSO₄

  • Co-express copper chaperones that facilitate copper loading

  • Maintain mildly aerobic conditions to prevent competitive iron binding

During Purification:

  • Include 1-5 μM Cu²⁺ in all purification buffers

  • Avoid strong chelating agents like EDTA

  • Maintain mild reducing conditions to keep copper in the correct oxidation state

Post-Purification Reconstitution:

  • Incubate purified protein with 10:1 molar excess of Cu²⁺

  • Remove excess copper using dialysis or gel filtration

  • Verify copper incorporation using atomic absorption spectroscopy

Verification Methods:

  • UV-Vis spectroscopy to confirm characteristic absorbance patterns

  • Electron paramagnetic resonance (EPR) to assess copper coordination environment

  • Inductively coupled plasma mass spectrometry (ICP-MS) for quantitative copper analysis

Proper copper incorporation can be confirmed by a Cu:protein stoichiometry approaching 2:1, consistent with the dinuclear copper center in functional MT-CO2 .

How can recombinant Rusa unicolor MT-CO2 contribute to understanding adaptive evolution in Cervidae?

Recombinant Rusa unicolor MT-CO2 serves as a valuable model for investigating adaptive evolution in Cervidae through several research approaches:

  • Comparative respiratory efficiency studies: By comparing the catalytic efficiency of recombinant MT-CO2 from different cervid species adapted to various habitats, researchers can correlate biochemical performance with environmental conditions. Rusa unicolor's tropical/subtropical adaptation may reveal distinct functional properties compared to temperate-adapted species.

  • Selection pressure analysis: Evidence of positive selection has been observed in other mitochondrial genes (ATP8, COX1) in certain cervid species comparisons . Similar analysis of MT-CO2 can reveal if this gene has undergone positive selection in Rusa unicolor lineages, potentially indicating adaptation to specific environmental challenges.

  • Thermal stability comparisons: Examining the thermal stability profiles of recombinant MT-CO2 from Rusa unicolor versus other cervids may reveal adaptations to different temperature regimes experienced in their native ranges.

The nucleotide composition analysis shows that mitochondrial genes across cervid species display patterns of both convergent evolution and ancestral polymorphism . For instance, the composition of COX1 and CYTB may have evolved convergently, while COX3, ND1, ND3, ND5, and tRNA genes likely represent ancestral states . These patterns provide insights into evolutionary pressures operating on mitochondrial genes in different deer lineages.

What insights can recombinant Rusa unicolor MT-CO2 provide about mitochondrial introgression events?

Recombinant Rusa unicolor MT-CO2 offers a unique tool for investigating hypothesized mitochondrial introgression events in cervid evolution. Phylogenetic analyses have revealed discordance between mitochondrial and nuclear genomic data, suggesting complex evolutionary histories involving potential gene flow between lineages .

Specifically, Rusa appears paraphyletic with respect to Cervus in mitochondrial DNA analyses, which could be explained by ancestral polymorphisms or mitochondrial introgression . To reconcile these conflicting phylogenies, researchers have proposed ancient introgression events involving the mitochondrial genome between various cervid species.

Research approaches using recombinant MT-CO2 to study introgression:

  • Functional comparison of chimeric constructs: Creating recombinant chimeric MT-CO2 proteins with domains from different species can test the functional compatibility of potentially introgressed sequences.

  • Biochemical signature analysis: Comparing kinetic parameters and stability profiles of MT-CO2 from species with suspected introgression histories can reveal functional convergence or divergence.

  • Coevolutionary studies with nuclear-encoded interaction partners: Examining the interaction between recombinant Rusa unicolor MT-CO2 and nuclear-encoded subunits from different species can provide evidence for coadaptation or mismatch, supporting or contradicting introgression hypotheses.

These approaches can help determine whether the observed phylogenetic patterns represent true introgression events or other evolutionary phenomena, contributing to our understanding of speciation and hybridization dynamics in mammals.

What methodological challenges exist in distinguishing between convergent evolution and ancestral polymorphism in MT-CO2?

Distinguishing between convergent evolution and ancestral polymorphism in MT-CO2 presents significant methodological challenges that require sophisticated analytical approaches. Based on correspondence analysis of nucleotide composition including ancestral sequence reconstruction, researchers have found evidence that certain genes (COX1, CYTB) likely evolved convergently in some cervid lineages, while others (COX3, ND1, ND3, ND5, tRNA genes) probably represent ancestral states .

Key methodological challenges and solutions:

  • Sequence similarity attribution problem

    • Challenge: Similar sequences between distantly related species could result from either convergence or incomplete lineage sorting

    • Solution: Implement coalescent-based methods that model ancestral population dynamics alongside phylogenetic reconstructions

    • Application: Compare evolutionary rates across different protein domains in recombinant MT-CO2 to identify regions under similar selective pressures

  • Distinguishing selection from drift

    • Challenge: Determining whether sequence similarities result from selective pressures or random processes

    • Solution: Calculate dN/dS ratios across different lineages and protein domains

    • Evidence: Significant positive selection has been demonstrated for other mitochondrial genes (ATP8, COX1) in certain cervid species comparisons

  • Inferring ancestral sequences

    • Challenge: Reconstructing ancestral states with high confidence

    • Solution: Employ Bayesian approaches that incorporate uncertainty in ancestral state reconstruction

    • Validation: Compare reconstructed ancestral sequences with extant species showing plesiomorphic traits

By combining these methodological approaches with functional studies of recombinant proteins, researchers can more confidently distinguish between convergent evolution and ancestral polymorphism in Rusa unicolor MT-CO2 and other mitochondrial genes.

How might CRISPR-based mitochondrial editing advance functional studies of recombinant MT-CO2?

Recent advances in mitochondrial genome editing technologies open new possibilities for functional studies of MT-CO2. While traditional CRISPR-Cas9 systems have been challenging to apply to mitochondrial DNA due to delivery limitations, new approaches are emerging:

  • MitoTALENs and base editors: These engineered nucleases can create specific modifications in mitochondrial genes, allowing researchers to introduce Rusa unicolor MT-CO2 variants into model systems for functional studies.

  • Mitochondrially-targeted cytidine and adenine deaminases: These systems enable precise C→T or A→G conversions without double-strand breaks, providing opportunities to study specific amino acid variations found in Rusa unicolor MT-CO2.

  • Dual organellar/nuclear expression systems: Developing cellular models that express recombinant Rusa unicolor MT-CO2 while controlling nuclear background allows dissection of mito-nuclear interactions and compatibility.

These approaches would enable researchers to test hypotheses about the functional consequences of sequence variations observed between Rusa unicolor and other cervid species, connecting genomic findings to biochemical mechanisms.

What computational approaches can improve structural predictions for recombinant Rusa unicolor MT-CO2?

Modern computational approaches offer powerful tools to predict and analyze the structure of Rusa unicolor MT-CO2:

  • AlphaFold2 and RoseTTAFold integration: These AI-based structure prediction tools can generate high-confidence models of Rusa unicolor MT-CO2, particularly useful for comparative structural analysis across cervid species.

  • Molecular dynamics simulations: Simulating MT-CO2 behavior within a lipid bilayer environment can reveal dynamic properties relevant to its function, including conformational changes during electron transfer.

  • Quantum mechanical/molecular mechanical (QM/MM) approaches: These hybrid methods are particularly valuable for modeling the copper centers and electron transfer processes in MT-CO2, providing insights into functional differences between species.

  • Coevolutionary analysis: Methods like direct coupling analysis can identify co-evolving residues across mitochondrial and nuclear-encoded subunits, highlighting important interaction networks that may differ between Rusa unicolor and other cervids.

These computational approaches, validated with experimental data from recombinant proteins, can provide mechanistic understanding of how sequence variations translate to functional differences in MT-CO2 across cervid species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.