Recombinant Rutilus rutilus Opsin-VA

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rutilus rutilus Opsin-VA

Recombinant Rutilus rutilus Opsin-VA is a genetically engineered protein derived from the roach (Rutilus rutilus), belonging to the vertebrate ancient (VA) opsin family. This photopigment is synthesized in E. coli expression systems with a His-tag for purification and functional studies . It plays a role in non-visual light detection and endocrine regulation, particularly in aquatic species .

Key Functional Roles

  • Light Sensitivity: Binds 11-cis-retinal to form a green-sensitive photopigment (λ<sub>max</sub> ~505 nm) .

  • Endocrine Interaction: Modulates gonadotropin hormones (FSH, LH) and estrogen receptors (ERα/ERβ) in fish reproductive pathways .

  • Non-Visual Signaling: Expressed in hypothalamic and retinal horizontal cells, influencing circadian rhythms and seasonal reproduction .

Hormonal Regulation in Goldfish

A 2018 study injected recombinant VAL-opsin into goldfish (Carassius auratus) under green-wavelength light (500–540 nm), observing significant increases in:

  • mRNA Expression:

    • Gonadotropin hormones (GTHα, FSH, LH) in the hypothalamus .

    • Estrogen receptors (ERα, ERβ) in gonads .

  • Plasma Hormone Levels:

    HormonePeak Activity (4 weeks post-injection)
    FSH2.5-fold increase vs. controls
    LH3.1-fold increase vs. controls
    17β-Estradiol2.8-fold increase vs. controls

Light-Dependent Activation

  • Green-wavelength light (520 nm) enhanced VAL-opsin’s effect on hormone secretion compared to white fluorescent light .

  • VAL-opsin interacts with G<sub>i</sub> and G<sub>t</sub> proteins, triggering depolarization in retinal horizontal cells .

Applications in Scientific Research

  1. Reproductive Physiology: Studying light-dependent regulation of sex hormones in teleosts .

  2. Neuroendocrinology: Investigating deep-brain photoreception mechanisms .

  3. Evolutionary Biology: Comparing VAL-opsin duplication events in teleosts (e.g., zebrafish VAL-opsinA/B) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
Opsin-VA; Vertebrate ancient opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Rutilus rutilus (Roach)
Target Protein Sequence
MELFPVAVNGVSHAEDPFSGPLTFIAPWNYKVLATLMFVVTAASLSENFAVMLVTFRFTQ LRKPLNYIIVNLSLADFLVSLTGGTISFLTNYHGYFFLGKWACVLEGFAVTYFGIVALWS LAVLAFERFFVICRPLGNIRLRGKHAALGLLFVWTFSFIWTIPPVLGWSSYTVSKIGTTC EPNWYSGNFHDHTFIIAFFITCFILPLGVIVVCYCKLIKKLRKVSNTHGRLGNARKPERQ VTRMVVVMIVAFMVAWTPYAAFSIVVTAHPSIHLDPRLAAAPAFFSKTAAVYNPVIYVFM NKQFRKCLVQLLRCRDVTIIEGNINQTSERQGMTNESHTGEMSTIASRIPKDGSIPEKTQ EHPGERRSLAHIPIPENKVCPM
Uniprot No.

Target Background

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a subset of retinal horizontal cells as well as in retinal ganglion cells.

Q&A

What is Rutilus rutilus Opsin-VA and what is its role in photoreception?

Rutilus rutilus Opsin-VA (also known as Vertebrate ancient opsin) is a photoreceptive protein found in the roach fish (Rutilus rutilus). Like other opsins, it functions as a light-sensitive G-protein coupled receptor that mediates photoreception through chromophore binding. This protein belongs to the Vertebrate Ancient (VA) opsin family, which represents one of several distinct evolutionary lineages of photoreceptive proteins across vertebrate species. The VA-opsin family is implicated in non-visual photoreception processes in various vertebrates, functioning in deep brain photoreceptors and potentially in peripheral light sensing .

What structural features define Rutilus rutilus Opsin-VA's function?

Rutilus rutilus Opsin-VA contains several critical structural features that define its function as a photoreceptive protein. The protein possesses the Pfam tm7_1 domain characteristic of seven-transmembrane G-protein coupled receptors. It contains a conserved lysine residue (homologous to Lys296 in bovine rhodopsin) that serves as the attachment site for the 11-cis-retinal chromophore. Additionally, it features the NPXXY motif important for receptor activation and the tripeptide motif (positions 310-312) crucial for G-protein activation. Notably, it appears to contain the NKQ motif at this position, which is characteristic of ciliary opsins but also present in some xenopsins .

What purification strategies yield highest recovery and purity of Recombinant Rutilus rutilus Opsin-VA?

The most effective purification strategy for Recombinant Rutilus rutilus Opsin-VA leverages affinity chromatography targeting the N-terminal His-tag. Current protocols yield protein preparations with purity greater than 90% as determined by SDS-PAGE analysis for full-length preparations and >85% for partial protein constructs . For functional studies of related opsins, extraction in dodecyl-β-D-maltoside-containing buffer has proven effective for maintaining the protein in a native-like conformation. This approach is particularly important when subsequent spectroscopic measurements are planned to assess chromophore binding and photosensitivity .

What are the optimal storage conditions to maintain Recombinant Rutilus rutilus Opsin-VA stability?

ParameterRecommendation
Long-term storage temperature-20°C/-80°C
Short-term working storage4°C (up to one week)
Storage bufferTris/PBS-based buffer, pH 8.0, with 6% Trehalose
Recommended additives5-50% glycerol (final concentration)
Shelf life (liquid form)6 months at -20°C/-80°C
Shelf life (lyophilized form)12 months at -20°C/-80°C
Critical considerationsAvoid repeated freeze-thaw cycles; aliquoting is necessary for multiple use

The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL prior to storage. Brief centrifugation is recommended prior to opening lyophilized preparations to bring contents to the bottom of the vial .

How can chromophore binding and photosensitivity of Recombinant Rutilus rutilus Opsin-VA be assessed?

Assessment of chromophore binding and photosensitivity requires reconstitution of the purified opsin with 11-cis-retinal followed by spectroscopic analysis. Based on methodologies applied to related VA-opsins, the recombinant protein should be extracted in a detergent-containing buffer (such as dodecyl-β-D-maltoside), reconstituted with an excess amount of 11-cis-retinal, and subjected to photobleaching experiments. The difference between absorption spectra measured before and after irradiation of the sample provides critical data on photosensitivity. The absorption maximum (λmax) can be determined by fitting the spectral curve at 480–700 nm to established template models such as the Lamb template. This approach allows researchers to characterize the spectral properties of the reconstituted photopigment and compare them with other opsins .

What spectral properties might be expected for Recombinant Rutilus rutilus Opsin-VA?

While the exact spectral properties of Rutilus rutilus Opsin-VA have not been directly reported in the search results, insights can be gained from studies of homologous proteins. Related VA-opsins demonstrate varying spectral sensitivities that appear species-specific:

VA-Opsin VariantSpeciesAbsorption Maximum (λmax)Sensitivity Range
VAL-opsinAZebrafish~510 nmGreen-sensitive
VAL-opsinBZebrafish~505 nmGreen-sensitive
VA-opsinSalmon~450 nmBlue-sensitive
Opsin-VARutilus rutilusNot determinedPredicted green-sensitive

The significant 54 nm spectral shift between zebrafish and salmon VA-opsins suggests that subtle amino acid differences in the binding pocket can substantially alter spectral tuning. Based on sequence homology, Rutilus rutilus Opsin-VA might be expected to form a green-sensitive pigment, but experimental verification is necessary .

How does Rutilus rutilus Opsin-VA relate phylogenetically to other opsin families?

Rutilus rutilus Opsin-VA belongs to the vertebrate ancient opsin (VA-opsin) family, which represents a distinct evolutionary lineage within the broader opsin superfamily. Phylogenetic analyses of opsins reveal several well-defined clades including ciliary opsins (c-opsins), rhabdomeric opsins (r-opsins), xenopsins, and VA-opsins. While initial classifications sometimes grouped VA-opsins with ciliary opsins, recent comprehensive phylogenetic analyses using both maximum-likelihood and Bayesian approaches suggest that VA-opsins represent a separate evolutionary lineage. This distinction is supported by conserved but unique gene structures and amino acid sequence motifs. The VA-opsin family appears to have originated early in vertebrate evolution and has been maintained in various lineages, though frequent gene loss events have shaped its current distribution across vertebrate species .

What evolutionary patterns of gene duplication are observed in VA-opsins across teleost fish?

Teleost fish show evidence of VA-opsin gene duplication events that have led to functional divergence. In zebrafish, for example, two distinct VA-opsin genes have been identified: VAL-opsinA and its duplicated paralog VAL-opsinB. Molecular phylogenetic analysis indicates that this duplication occurred specifically in the teleost lineage. The duplicated genes show differential expression patterns in the brain and eye, suggesting subfunctionalization following duplication. This pattern aligns with the teleost-specific genome duplication event that has been documented across many gene families. The presence of VA-opsin in Rutilus rutilus, another teleost fish, suggests potential similar duplication patterns, though specific evidence for multiple VA-opsin genes in this species is not provided in the search results .

How can Recombinant Rutilus rutilus Opsin-VA be employed in optogenetic applications?

While not directly addressed in the search results for Rutilus rutilus Opsin-VA, related research suggests potential optogenetic applications. VA-opsins with characterized spectral properties offer promising tools for controlling neural activity with light. The green sensitivity of zebrafish VA-opsins (~505-510 nm) provides a spectral range distinct from commonly used blue-light sensitive channelrhodopsins. Development of a Rutilus rutilus Opsin-VA optogenetic tool would require functional characterization of its photocycle kinetics, G-protein coupling specificity, and expression optimization in target neurons. Viral delivery methods, such as those using recombinant adeno-associated virus (rAAV) vectors with tissue-specific promoters, have been successfully employed for opsin gene delivery to photoreceptors and could potentially be adapted for expression of Rutilus rutilus Opsin-VA in neural circuits of interest .

What approaches can resolve the structure-function relationship of spectral tuning in Rutilus rutilus Opsin-VA?

Resolving the structure-function relationship in Rutilus rutilus Opsin-VA spectral tuning requires a multi-faceted approach combining molecular, spectroscopic, and computational techniques. Site-directed mutagenesis of key residues surrounding the chromophore binding pocket, followed by spectroscopic analysis of the mutant proteins, can identify critical amino acids involved in spectral tuning. Homology modeling based on crystallized opsin structures can predict chromophore interaction sites. Comparative analysis with other VA-opsins displaying different spectral properties, such as the blue-sensitive salmon VA-opsin versus green-sensitive zebrafish VA-opsins, can highlight candidate residues for experimental verification. Additionally, analyzing natural variation in VA-opsin sequences across fish species adapted to different light environments may reveal evolutionary patterns of spectral tuning. These approaches together can elucidate how specific amino acid changes influence the absorption properties of Rutilus rutilus Opsin-VA .

How might differential expression patterns inform the physiological role of VA-opsins in non-visual photoreception?

Understanding differential expression patterns of VA-opsins provides critical insights into their physiological roles. In zebrafish, VAL-opsinA and VAL-opsinB show distinct expression patterns despite their close evolutionary relationship, suggesting subfunctionalization following gene duplication. VAL-opsinA is expressed in deep brain cells and retinal horizontal cells, while VAL-opsinB shows a more restricted expression pattern. These differential expression patterns suggest involvement in distinct photosensitive physiological processes. To determine the physiological role of Rutilus rutilus Opsin-VA, in situ hybridization studies could map its expression across brain regions, retina, and potential extraocular tissues. Correlation of expression patterns with known photosensitive behaviors (such as circadian entrainment, photoperiodic responses, or light-dependent locomotor activity) could elucidate its specific functions. Additionally, analysis of transcription factors regulating its expression, such as Foxj1 and RFX which are involved in ciliary photoreceptor development, may provide further insights into its cellular context and developmental regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.