Recombinant Sabia virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request when possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
255-488
Protein Length
Full Length of Mature Protein
Species
Sabia mammarenavirus (isolate Human/Brasil/SPH114202/1990) (SABV) (Sabi mammarenavirus)
Target Names
GPC
Target Protein Sequence
GIFSWTITDAVGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLDHDSEFCDMLKLFEFN KKAIETLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLNTPYCNYTKFWYVNHTASGE HSLPRCWLVRNNSYLNESEFRNDWIIESDHLLSEMLNKEYIDRQGKTPLTLVDICFWSTL FFTTTLFLHLVGFPTHRHIRGEPCPLPHRLNSRGGCRCGKYPELKKPITWHKNH
Uniprot No.

Target Background

Function
This recombinant Sabia virus Pre-glycoprotein polyprotein GP complex (GPC) interacts with the host receptor, mediating viral attachment to host TFRC. This attachment primarily initiates virion internalization via clathrin-mediated endocytosis. The GPC is a class I viral fusion protein that facilitates fusion between viral and host endosomal membranes, subsequently delivering the nucleocapsid into the cytoplasm. This membrane fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide, while also remaining as the third component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion.
Database Links

KEGG: vg:3077252

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and composition of Sabia virus GPC?

The SABV glycoprotein complex (GPC) is a 70-80 kDa polyprotein precursor that undergoes proteolytic processing to form three functional subunits: the stable signal peptide (SSP), glycoprotein 1 (GP1), and glycoprotein 2 (GP2). These three components form a tripartite complex organized into trimeric viral spikes on the virion surface . Unlike most viral glycoproteins, arenavirus GPCs uniquely retain their signal peptide (SSP) as an integral functional component of the mature complex. The SSP is myristoylated and participates in membrane fusion activity, while GP1 mediates receptor binding and GP2 anchors the complex to the viral envelope .

What cellular receptors does Sabia virus GPC interact with during infection?

The GP1 subunit of SABV GPC binds to the human transferrin receptor 1 (TfR1) to mediate viral attachment to target cells. TfR1 is widely expressed in human tissues, particularly in those with high proliferative capacity such as bone marrow and placenta, explaining the broad tissue tropism of SABV . This interaction is a critical determinant of host range and tissue specificity for New World arenaviruses like SABV.

What are the key challenges in producing functional recombinant SABV GPC?

The production of functional recombinant SABV GPC presents several significant challenges:

  • Post-translational modifications: The proper glycosylation of GPC is essential for its functionality, requiring mammalian expression systems that can recapitulate these modifications . SABV GP1 is heavily glycosylated, and these glycans are critical for proper folding, receptor binding, and immune evasion.

  • Proteolytic processing: Authentic cleavage of GPC by host proteases (primarily SKI-1/S1P) is required to generate mature GP1 and GP2 subunits, which necessitates co-expression of appropriate proteases or processing in cells expressing these enzymes .

  • Tripartite complex stability: Maintaining the non-covalent association between SSP, GP1, and GP2 during purification requires careful optimization of detergents and buffer conditions to preserve functional interactions .

  • Biosafety considerations: While recombinant proteins themselves don't require BSL-4 facilities, researchers must implement appropriate safety measures to ensure that recombinant GPC cannot reconstitute infectious particles when combined with other viral components .

How can neutralizing epitopes be identified in recombinant SABV GPC?

Identifying neutralizing epitopes in SABV GPC requires a multifaceted approach:

  • Structure-guided mapping: Using predicted or experimentally determined GPC structures to identify surface-exposed regions likely to be targeted by neutralizing antibodies.

  • Pseudotype neutralization assays: Vesicular stomatitis virus (VSV)-based pseudotypes bearing SABV recombinant glycoproteins can be used to screen for neutralizing antibodies without requiring BSL-4 containment .

  • Epitope mapping: Employing techniques such as peptide arrays, alanine scanning mutagenesis, or competition binding assays to identify specific amino acids critical for antibody recognition.

  • Cross-reactive antibody analysis: Evaluating antibodies that neutralize multiple arenaviruses to identify conserved epitopes that could serve as targets for broad-spectrum therapeutics .

What strategies can overcome the structural variability in GP1 for diagnostic applications?

GP1 exhibits high variability among arenaviruses, creating challenges for diagnostic development. Researchers can address this through:

  • Consensus sequence design: Creating recombinant GP1 constructs based on consensus sequences from multiple SABV isolates to capture broader variant recognition.

  • Conserved epitope targeting: Identifying and focusing on relatively conserved regions within GP1 that are still sufficiently unique to SABV.

  • Multiplexed approaches: Developing assays that simultaneously target multiple epitopes or viral proteins (including the more conserved NP) to improve sensitivity and specificity .

  • Structural biology insights: Using structural predictions to engineer stabilized forms of GP1 that better present diagnostically relevant epitopes while maintaining native-like conformations .

What expression systems are optimal for producing recombinant SABV GPC?

The choice of expression system significantly impacts the quality and functionality of recombinant SABV GPC:

Expression SystemAdvantagesLimitationsBest Applications
Mammalian cells (HEK293, CHO)Native-like glycosylation; Proper folding and processingHigher cost; Lower yieldFunctional studies; Antibody development; Structural analysis
Insect cells (Sf9, High Five)Higher yield than mammalian; Some post-translational modificationsDifferent glycosylation patternsStructural studies; High-throughput screening
Bacterial systems (E. coli)High yield; Low cost; Rapid productionNo glycosylation; Often misfoldedLinear epitope studies; Peptide-based assays
Cell-free systemsAvoids biosafety concerns; Rapid protein synthesisLimited post-translational modificationsPreliminary binding studies; Epitope mapping

Mammalian expression systems, particularly HEK293 cells, are generally preferred for producing functional SABV GPC due to their ability to properly fold and process the protein with appropriate glycosylation patterns .

How can pseudotype systems be optimized for SABV GPC functional studies?

Pseudotype viral systems provide a valuable tool for studying SABV GPC function outside BSL-4 containment:

  • Vector selection: Vesicular stomatitis virus (VSV) or lentiviral vectors with deleted native envelope proteins serve as effective backbones for SABV GPC pseudotyping .

  • Codon optimization: Adapting the SABV GPC coding sequence to the preferred codon usage of the production cell line improves expression levels.

  • Chimeric constructs: Creating chimeric GPCs containing the ectodomain of SABV GP with transmembrane/cytoplasmic domains from VSV-G can enhance incorporation into pseudotype particles.

  • Quantification methods: Standardizing pseudotype production through p24 ELISA (for lentiviral systems) or quantitative PCR ensures consistent results across experiments.

  • Validation controls: Including pseudotypes bearing well-characterized viral glycoproteins (VSV-G, LASV GPC) as controls helps contextualize SABV GPC functionality .

What diagnostic platforms can effectively utilize recombinant SABV GPC?

Multiple diagnostic platforms can be developed using recombinant SABV GPC:

  • Enzyme-linked immunosorbent assays (ELISAs): Recombinant GPC or its subunits can be used as capture antigens to detect anti-SABV antibodies in patient sera, with particular utility for IgM and IgG detection .

  • Lateral flow assays: Simplified point-of-care testing can be developed using purified recombinant GPC conjugated to colored particles.

  • Pseudotype neutralization assays: Patient sera can be screened for neutralizing antibodies against SABV using GPC-bearing pseudoviruses, providing information on functional immunity .

  • Multiplex bead-based assays: Coupling recombinant GPC to distinct microspheres allows simultaneous detection of antibodies against multiple hemorrhagic fever viruses in a single sample .

How can recombinant SABV GPC contribute to vaccine development?

Recombinant SABV GPC offers several promising approaches for vaccine development:

  • Subunit vaccines: Purified recombinant GPC or GP1/GP2 subunits can be formulated with adjuvants to elicit neutralizing antibody responses. This approach benefits from the absence of replicating virus, enhancing safety profiles .

  • Virus-like particles (VLPs): Co-expression of GPC with the viral matrix protein Z generates non-infectious VLPs that mimic authentic virions, potentially inducing more robust immune responses.

  • DNA vaccines: Plasmids encoding optimized SABV GPC can induce both humoral and cellular immunity when administered via appropriate delivery systems.

  • Vector-based vaccines: Viral vectors (adenovirus, modified vaccinia Ankara) expressing SABV GPC have shown promise for related arenaviruses and could be adapted for SABV protection .

Research indicates that protection against arenavirus infection strongly correlates with neutralizing antibody titers against the viral glycoproteins, making GPC-based approaches particularly promising .

What role can recombinant SABV GPC play in therapeutic development?

Recombinant SABV GPC serves as a critical tool for therapeutic development through:

  • Antibody screening: High-throughput screening of antibody libraries against recombinant GPC can identify neutralizing antibodies with therapeutic potential.

  • Drug target identification: Structural analysis of recombinant GPC can reveal potential binding pockets for small molecule inhibitors targeting fusion or receptor binding .

  • Inhibitor validation: Compounds that inhibit host proteases required for GPC processing (such as SKI-1/S1P inhibitors) can be evaluated using recombinant GPC expression systems .

  • Cross-reactive therapeutics: Identification of antibodies that recognize conserved epitopes across multiple arenaviruses could lead to broad-spectrum therapeutics applicable to SABV .

How can researchers overcome the BSL-4 requirement for SABV studies?

SABV is classified as a BSL-4 pathogen, creating significant research barriers. Strategies to conduct meaningful research without BSL-4 facilities include:

  • Recombinant protein work: Using isolated recombinant viral proteins like GPC for structural, biochemical, and immunological studies .

  • Pseudotype systems: Developing VSV or lentiviral pseudotypes bearing SABV GPC to study entry and neutralization in BSL-2 conditions .

  • Minigenome systems: Creating replication-competent but non-infectious viral minigenomes to study aspects of SABV replication.

  • Surrogate viruses: Working with less pathogenic arenaviruses that share key features with SABV to gain preliminary insights.

  • Collaborative approaches: Establishing partnerships with institutions that have BSL-4 capabilities to validate findings from surrogate systems .

These approaches have enabled significant advancements in SABV research despite the limited availability of BSL-4 infrastructure, particularly in Brazil where the virus was first isolated .

What quality control measures are essential for recombinant SABV GPC research?

Ensuring consistent, high-quality recombinant SABV GPC requires rigorous quality control:

  • Protein authentication: Confirming identity through mass spectrometry and N-terminal sequencing to verify proper processing of SSP, GP1, and GP2.

  • Functional validation: Verifying receptor binding capacity through TfR1 binding assays and fusion function through pseudotype infection assays .

  • Structural integrity: Employing circular dichroism or thermal shift assays to confirm proper protein folding and stability.

  • Glycosylation analysis: Characterizing glycan profiles using lectin binding assays or mass spectrometry to ensure native-like post-translational modifications.

  • Batch consistency: Establishing reference standards and acceptance criteria for lot-to-lot comparisons to maintain experimental reproducibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.