Recombinant Saccharomyces bayanus Sterol O-acyltransferase 1 (ARE1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces bayanus Sterol O-Acyltransferase 1 (ARE1)

Recombinant Saccharomyces bayanus Sterol O-acyltransferase 1 (ARE1) is a full-length, His-tagged protein (1–623 amino acids) derived from S. bayanus (or S. uvarum, a synonym). This enzyme catalyzes the esterification of sterols (e.g., ergosterol, lanosterol) with fatty acyl-CoA, forming steryl esters that regulate lipid metabolism and membrane stability in yeast. ARE1 is distinct from its homolog ARE2 (Sterol O-acyltransferase 2), which preferentially esterifies ergosterol, the mature sterol in yeast .

Subcellular Localization and Catalytic Activity

ARE1 localizes to the endoplasmic reticulum (ER), as confirmed by fluorescence microscopy and subcellular fractionation . Its enzymatic activity is critical for:

  • Sterol precursor storage: Esterifies sterol intermediates (e.g., lanosterol) during anaerobic growth or metabolic stress .

  • Lipid homeostasis: Compensates for sterol ester deficiencies in are1are2 mutants via increased free sterol levels .

Substrate Specificity

SubstrateARE1 PreferenceARE2 Preference
ErgosterolModerateHigh
LanosterolHighLow
Fatty Acyl-CoASimilar to ARE2Similar to ARE1

ARE1 preferentially esterifies sterol precursors, while ARE2 targets mature ergosterol .

Regulatory Mechanisms

ARE1 expression is modulated by:

FactorEffect on ARE1Mechanism
Heme deficiency↑ 5-foldUpregulation under anaerobic conditions .
Oxygen levelsRepressed by ROX1 (oxygen-dependent repressor) .
Sterol precursorsInduced when sterol intermediates accumulate .

ARE1 transcription is independent of sterol ester levels, unlike in mammals .

Key Experimental Insights

  1. Growth Competition: are1are2 mutants grow slower than wild-type under natural conditions, highlighting ARE1/ARE2’s ecological importance .

  2. Terbinafine Sensitivity: are1are2 mutants are more susceptible to ergosterol biosynthesis inhibitors, indicating sterol esters buffer sterol depletion .

  3. Anaerobic Adaptation: ARE1 compensates for reduced ergosterol synthesis under low-oxygen conditions .

Industrial Relevance

ApplicationRole of ARE1
Wine/Cider FermentationModulates sterol ester levels in S. bayanus hybrids for flavor/stability .
Lipid MetabolismModel for studying sterol storage in yeast .

Future Directions

  • Metabolic Engineering: Enhancing sterol ester synthesis in industrial yeasts for biofuel production.

  • Stress Response Studies: Investigating ARE1’s role in lipid remodeling under osmotic or oxidative stress.

References

  1. Yang et al. (1996) – Subcellular localization and substrate specificity .

  2. Yu et al. (1996) – Transcriptional regulation and anaerobic adaptation .

  3. Creative BioMart (2025) – Recombinant ARE1 production details .

  4. Nakao et al. (2006) – Genetic diversity in S. bayanus hybrids .

  5. Wikipedia (2024) – Taxonomic classification and industrial use .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARE1; Sterol O-acyltransferase 1; Sterol-ester synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) (Yeast) (Saccharomyces bayanus var. uvarum)
Target Names
ARE1
Target Protein Sequence
MTEAKELLQDERFLKIQELNSAEPSKRHSVTYDNVILPQESVEVSPRSSTTSLEEPATTT ATGVAVAAAAAAAEKKKKKKGEDGDDEQDEQAEEKYPVDPRMQKYLSHLKSKSRTRVHRK DASKYVSFFGDVSFDPRPTLLDSAVNVPFQTTFKGPVLEKQLKGLQQTKKGEVAAAAATA ATAATAAAAPPGKKLESNFSGIYVFAWMFMGWIAFRSCMDYYVSHEGGFASMEIVQYMTS DLFTIALLDLALFLSTFFVVFVHWLVKLGFIRWKWTGFVAVSLFELCFIPVSFPVYVYYF HFSWVTRIFLFLHSVVLLMKAHSFAFYNGYLWDIKNELEFSSNKLNKFKESLSPETKDIL QKSCDFCLFELNYQTKDNDFPNNISCSNYFMFCMFPVLVYQINYPRTSHIRWRYVLEKFC AIMGTIFLMMVTAQIFMHPVAMRCIEYHDTPSFGGWVPAVKQWLFLLFEMIPGFSVLYML TFYMIWDALLNCVAELTRFADRYFYGDWWNCVSFEEFSRIWNVPVHKFLLRHVYHSSMGA LHFSKAQATLFTFLLSAVFHEIAMFAIFKEVRGYLFLFQLSQFAWTALSNTKFLRSRPQL SNVVFTFGVCTGPSMIMTLYLTL
Uniprot No.

Target Background

Function
Sterol O-acyltransferase catalyzes the formation of steryl esters.
Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Sterol O-acyltransferase 1 (ARE1) in Saccharomyces bayanus and what is its primary function?

Sterol O-acyltransferase 1 (ARE1) in Saccharomyces bayanus is an enzyme responsible for catalyzing the esterification of sterols, a critical process in lipid metabolism and membrane homeostasis. This enzyme belongs to a conserved family of acyltransferases present across different Saccharomyces species. In contrast to its homolog in Saccharomyces cerevisiae, which shows a preferential role in esterifying sterol intermediates rather than the end product ergosterol, S. bayanus ARE1 demonstrates distinct substrate preferences and regulation patterns. Research indicates that when heterologously expressed, ARE1 preferentially acylates lanosterol, contributing to 88.1% of total sterol moiety in sterol esters . This functional specificity highlights its importance in sterol metabolism regulation during various growth conditions, particularly in mediating lipid composition changes during anaerobic growth when heme becomes limiting and sterol precursors may accumulate .

How does the recombinant form of S. bayanus ARE1 differ from its native form?

The recombinant form of S. bayanus ARE1 typically refers to the protein expressed in heterologous systems like Escherichia coli, as opposed to its native expression in yeast cells. According to available data, recombinant full-length S. bayanus ARE1 protein (comprising amino acids 1-623) can be successfully expressed with an N-terminal histidine tag in E. coli expression systems . While this recombinant form maintains the primary sequence of the native protein, several key differences exist in terms of post-translational modifications, protein folding dynamics, and subcellular localization.

The addition of affinity tags (such as the His-tag) facilitates purification but may subtly alter protein conformation or substrate binding. Unlike the native enzyme that functions within the endoplasmic reticulum membrane of yeast cells, the recombinant protein lacks the native lipid environment that can influence enzyme activity and specificity. Researchers should consider these differences when interpreting experimental results, as the recombinant form may exhibit altered kinetic parameters or substrate preferences compared to the native enzyme functioning in its natural cellular context.

What are the differences between ARE1 in S. bayanus and its homologs in other Saccharomyces species?

ARE1 in S. bayanus shares functional similarities with its homologs in other Saccharomyces species but exhibits distinct regulatory patterns and physiological roles. When compared to S. cerevisiae, where both ARE1 and ARE2 genes contribute to sterol esterification, important differences emerge in expression levels, transcript stability, and functional specialization. In S. cerevisiae, ARE2 serves as the major enzyme isoform during aerobic growth, while ARE1 plays a more prominent role during anaerobic conditions .

The differential regulation is achieved through several mechanisms: (1) transcriptional initiation from the ARE1 promoter is significantly reduced compared to the ARE2 promoter; (2) the half-life of ARE2 mRNA is approximately 12 times longer than that of ARE1 transcript; and (3) the two genes respond oppositely to heme availability—ARE1 is upregulated fivefold under heme-deficient conditions while ARE2 is downregulated . These differences reflect adaptive specialization, with ARE1 primarily esterifying sterol intermediates and ARE2 preferentially esterifying ergosterol, the end product of the pathway. S. bayanus strains demonstrate different fermentation kinetics compared to other Saccharomyces species, which may relate to differences in sterol metabolism regulated by ARE1 .

What experimental approaches are most effective for studying ARE1 transcriptional regulation in S. bayanus?

Studying ARE1 transcriptional regulation in S. bayanus requires a multi-faceted experimental approach that combines molecular genetics, biochemical analyses, and advanced imaging techniques. Based on successful approaches used with related yeasts, researchers should consider:

  • Promoter fusion constructs: Creating ARE1 promoter fusions with reporter genes (such as lacZ or fluorescent proteins) allows quantitative assessment of promoter activity under various conditions. This approach has successfully demonstrated differential transcriptional initiation between ARE1 and ARE2 promoters in S. cerevisiae .

  • Chromatin immunoprecipitation (ChIP): To identify transcription factors that bind to the ARE1 promoter, ChIP followed by sequencing (ChIP-seq) can map DNA-protein interactions across the genome. This is particularly relevant for investigating whether transcription factors like HAP1 and ROX1, which regulate ARE genes in S. cerevisiae, play similar roles in S. bayanus.

  • RNA stability assays: Since transcript stability contributes significantly to gene expression levels, measuring ARE1 mRNA half-life using transcription inhibitors (like thiolutin) followed by quantitative RT-PCR at various time points can reveal post-transcriptional regulatory mechanisms.

  • Growth condition variations: Systematic testing of ARE1 expression under different oxygen levels, heme concentrations, sterol availability, and nitrogen conditions provides insights into environmental regulation. In S. cerevisiae, ARE1 is upregulated fivefold under heme-deficient conditions, suggesting a similar experimental design for S. bayanus studies .

  • Genetic manipulations: Creating knockout and overexpression strains helps establish the role of specific regulators. For instance, examining ARE1 expression in rox1 mutant backgrounds could determine if the repressor of oxygen (ROX1) influences ARE1 regulation in S. bayanus as it does in S. cerevisiae.

These methodologies, used in combination, provide comprehensive insights into the complex regulatory network controlling ARE1 transcription in S. bayanus.

How can researchers accurately assess the substrate specificity of recombinant S. bayanus ARE1 protein?

Accurately assessing substrate specificity of recombinant S. bayanus ARE1 presents several methodological challenges that researchers must address through careful experimental design. A comprehensive approach includes:

When interpreting results, researchers should note that additional factors may influence apparent substrate preference. For instance, experiments have shown that even vector-only control strains display reduced 16:0 acylation activity in the presence of exogenous sterol, and addition of ergosterol to yeast lysates expressing heterologous acyltransferases can yield negative values on sterol ester formation . These observations underscore the complexity of sterol acyltransferase assays and the need for appropriate controls.

What approaches can resolve contradictions in ARE1 functional studies across different experimental systems?

Resolving contradictions in ARE1 functional studies requires systematic analysis of methodological differences and biological variables that might influence experimental outcomes. Researchers should implement these strategies:

  • Standardized expression systems comparison: Directly compare ARE1 function in multiple expression systems (E. coli, yeast, insect cells) using identical protein constructs and assay conditions. This helps identify system-specific artifacts versus genuine functional properties. When expressing ARE1 in heterologous systems, careful validation is needed as substrate preferences can be dramatically altered based on the expression context .

  • Data integration framework: Implement a structured approach to identify contradictions through systematic literature review and meta-analysis. Organize findings into categories of agreement and disagreement, then map these to methodological differences. This process can be modeled after conflict detection frameworks used in retrieval augmented generation systems, where contradictions are classified as self-contradictory findings, contradicting result pairs, or conditional contradictions .

  • Multi-omics validation: Cross-validate functional claims using complementary approaches:

    • Transcriptomics: RNA-seq to verify ARE1 expression patterns

    • Proteomics: Mass spectrometry to confirm protein levels and modifications

    • Metabolomics: Lipidomic profiling to assess sterol ester compositions

    • Genetics: Phenotypic analysis of ARE1 mutants

  • Control for strain differences: Different S. bayanus strains show variable fermentation behaviors , which may influence ARE1 function. Using genetically defined strains and reporting their complete provenance reduces ambiguity when comparing studies.

  • Context-dependent interpretation: Consider that contradictions may reflect genuine biological complexity rather than experimental error. For example, ARE genes in S. cerevisiae show opposite regulation by heme—ARE1 is upregulated fivefold under heme-deficient conditions while ARE2 is downregulated . Similar context-dependent functions may explain apparently contradictory results for S. bayanus ARE1.

  • Collaborative validation: Establish multi-laboratory validation studies where identical experiments are performed using shared protocols and materials, minimizing lab-specific variables.

By applying these approaches systematically, researchers can distinguish between methodological artifacts and genuine biological complexity, leading to a more coherent understanding of ARE1 function across experimental systems.

What is the optimal expression system for producing functional recombinant S. bayanus ARE1 protein?

The optimal expression system for producing functional recombinant S. bayanus ARE1 protein depends on research objectives, required protein yield, and desired post-translational modifications. Each system offers distinct advantages and limitations:

  • E. coli expression system:

    • Advantages: Rapid growth, high protein yields, well-established protocols, and economical production.

    • Limitations: Lack of eukaryotic post-translational modifications, potential issues with membrane protein folding, and formation of inclusion bodies.

    • Optimization strategies: Use specialty E. coli strains (like Rosetta for rare codons), lower induction temperatures (16-20°C), and specialized vectors containing solubility-enhancing tags (SUMO, MBP, or TRX).

    • Current practice: Successfully implemented for S. bayanus ARE1, with the full-length protein (1-623 amino acids) expressed with an N-terminal His tag .

  • Yeast expression systems:

    • Advantages: Native-like membrane environment, proper folding machinery, and relevant post-translational modifications.

    • Options:

      • S. cerevisiae: Provides a genetically tractable host closely related to S. bayanus

      • Pichia pastoris: Allows for high-density fermentation and strong inducible expression

    • Considerations: When expressed in S. cerevisiae, ARE1 shows specific activity toward lanosterol, with sterol esters containing 88.1% lanosterol as the sterol moiety .

  • Insect cell/baculovirus system:

    • Advantages: Superior for eukaryotic membrane proteins, allowing proper folding and post-translational modifications.

    • Limitations: Higher cost, longer production time, and more complex methodology.

    • Best for: Structural biology applications requiring highly purified, correctly folded protein.

The optimal choice should be determined by conducting parallel expression trials in multiple systems, followed by activity assays to confirm functionality. For basic biochemical characterization, E. coli expression may be sufficient, while studies requiring native-like enzyme properties should consider yeast or insect cell systems.

How can researchers accurately measure and interpret ARE1 enzyme kinetics?

Accurately measuring and interpreting ARE1 enzyme kinetics requires specialized approaches due to the membrane-associated nature of the enzyme and its hydrophobic substrates. A comprehensive methodology includes:

  • Preparation of active enzyme:

    • Membrane isolation: Isolate membrane fractions containing ARE1 through differential centrifugation.

    • Protein solubilization: Use mild detergents (DDM, CHAPS, or digitonin) at concentrations that maintain enzyme activity.

    • Purification strategy: Implement affinity chromatography followed by size exclusion to obtain homogeneous protein preparations.

  • Kinetic assay design:

    • Substrate preparation: Solubilize sterols and acyl-CoA donors effectively without inhibiting enzyme activity.

    • Reaction monitoring: Use radioisotope-labeled substrates ([14C]palmitoyl-CoA) or fluorescent detection systems for real-time monitoring.

    • Product analysis: Implement TLC, HPLC, or LC-MS/MS for quantitative product detection.

  • Enzyme kinetics determination:

    • Initial velocity measurements: Ensure measurements occur in the linear range of product formation.

    • Substrate titration: Perform assays with varying concentrations of both sterol acceptors and acyl-CoA donors.

    • Data fitting: Apply appropriate models (Michaelis-Menten, Hill equation, or more complex models for multi-substrate enzymes) using nonlinear regression.

  • Addressing technical challenges:

    • Endogenous sterol interference: Implement β-cyclodextrin washes to extract free sterols from membrane preparations .

    • Background activity subtraction: Control reactions should be performed without added sterol substrates.

    • Detergent effects: Test multiple detergent types and concentrations to optimize activity while minimizing interference.

  • Interpretation framework:

    • Apparent kinetic parameters: Report Km and Vmax values as "apparent" when using membrane preparations.

    • Substrate preference index: Calculate relative catalytic efficiency (kcat/Km) for different substrates to determine preference.

    • Inhibition studies: Use competitive inhibitors to validate substrate binding sites.

When interpreting kinetic data, researchers should note that even control experiments may display complex behaviors. For instance, the addition of exogenous sterols to yeast lysates can result in reduced activity or negative values for sterol ester formation , suggesting competitive effects from endogenous components.

What methods can determine ARE1's role in mixed Saccharomyces species fermentations?

Determining ARE1's role in mixed Saccharomyces species fermentations requires integrating molecular techniques with fermentation monitoring and lipid analysis. A comprehensive methodology includes:

  • Experimental fermentation design:

    • Pure vs. mixed cultures: Compare fermentation dynamics between pure S. bayanus cultures and mixed cultures containing S. bayanus and other Saccharomyces species (e.g., S. pastorianus).

    • Strain selection: Use genetically characterized strains with known ARE1 expression profiles, such as the documented mixed fermentation between S. bayanus strain Sb1 and S. pastorianus strain Sp1, where S. bayanus achieved higher population levels .

    • Inoculation ratios: Control initial cell populations carefully, considering that differences in viable cell counts between products can significantly influence fermentation dynamics.

  • Population dynamics monitoring:

    • Species-specific quantification: Implement qPCR with species-specific primers to track population changes during fermentation.

    • Colony morphology analysis: When applicable, use differential media that distinguish between species based on colony appearance.

    • Flow cytometry: Apply fluorescent labeling techniques to distinguish and quantify different species in real-time.

  • Gene expression analysis:

    • Transcript quantification: Develop species-specific primers for RT-qPCR to measure ARE1 expression in each species during mixed fermentation.

    • Transcriptomics: Apply RNA-seq with bioinformatic pipelines capable of assigning reads to their species of origin.

    • Proteomics: Implement targeted or untargeted proteomics to measure ARE1 protein levels during fermentation.

  • Functional analysis:

    • Gene knockout experiments: Create ARE1 deletion strains in S. bayanus and assess their performance in pure and mixed fermentations.

    • Fermentation parameters tracking: Monitor sugar consumption, ethanol production, and fermentation kinetics as shown in Table 1.

Fermentation SchemeInitial Sugar (g/L)Final Sugar (g/L)Sugar Consumption RateDominant Species
Sb1 (pure)20035 ± 0.8HighS. bayanus
Sp1 (pure)20072 ± 0.4MediumS. pastorianus
Sb1Sp1 (mixed)20016 ± 1Very HighS. bayanus
  • Sterol metabolism profiling:

    • Sterol ester analysis: Quantify sterol ester species during fermentation using LC-MS/MS.

    • Membrane composition: Analyze membrane sterol content to assess the impact of ARE1 activity on membrane properties.

    • Correlation analysis: Relate sterol metabolism changes to fermentation performance metrics.

This integrated approach allows researchers to establish connections between ARE1 activity, sterol metabolism, and fermentation performance in mixed culture systems that better represent industrial brewing and wine-making conditions .

How might ARE1 function be leveraged to improve yeast strain performance in industrial fermentations?

Leveraging ARE1 function to improve yeast strain performance in industrial fermentations represents a promising frontier in metabolic engineering. Strategic approaches include:

The implementation of these approaches requires thorough understanding of ARE1's role in different Saccharomyces species and careful consideration of the specific industrial application's requirements.

What are the implications of ARE1 functional conservation between yeast and plants for agricultural research?

The functional conservation of ARE1 between yeast and plants offers significant implications for agricultural research, particularly in understanding and improving plant stress responses and nutrient utilization efficiency. This cross-kingdom conservation provides:

  • Mechanistic insights into nitrogen utilization efficiency:

    • Research has identified ARE1 as a key mediator of nitrogen utilization efficiency (NUE) in rice, with loss-of-function mutations causing delayed senescence and 10-20% grain yield increases under nitrogen-limiting conditions .

    • The conservation between yeast and plant ARE1 functions suggests shared fundamental mechanisms in nutrient response pathways that could be leveraged in crop improvement.

    • Comparative genomics approaches can identify conserved regulatory elements controlling ARE1 expression across species, potentially revealing universal stress response mechanisms.

  • Translational research opportunities:

    • Yeast as a model system: The well-characterized S. bayanus ARE1 can serve as a tractable model for studying complex plant ARE1 functions, enabling faster hypothesis testing and mechanism elucidation.

    • Heterologous expression: Plant ARE1 genes can be expressed in yeast to assess functional conservation and substrate specificity, as demonstrated with Arabidopsis sterol O-acyltransferase expression in yeast .

    • Genetic engineering targets: Conservation patterns can guide targeted modifications of plant ARE1 genes to improve agricultural traits based on insights from yeast studies.

  • Evolutionary perspectives on sterol metabolism:

    • Cross-species comparisons reveal that ARE1 in plants preferentially acylates lanosterol when expressed in yeast , similar to preferences observed in fungal systems.

    • This conservation suggests fundamental roles of sterol esterification in eukaryotic stress responses that have been maintained through evolution.

  • Practical applications in agriculture:

    • Genetic markers: Natural variations in plant ARE1 promoters can serve as breeding markers for improved NUE, as demonstrated in rice where 18% of indica and 48% of aus accessions carry small insertions in the ARE1 promoter, resulting in reduced ARE1 expression and increased grain yield under nitrogen-limiting conditions .

    • Crop improvement strategies: CRISPR-Cas9 editing of ARE1 regulatory regions in crops represents a promising approach for improving nutrient efficiency without introducing foreign genes.

This cross-kingdom functional conservation highlights ARE1 as a promising target for both fundamental research and applied agricultural improvements.

What are the most critical knowledge gaps in our understanding of S. bayanus ARE1 function?

Despite significant advances in understanding Saccharomyces bayanus ARE1 function, several critical knowledge gaps persist that limit our comprehensive understanding of this enzyme's role in yeast physiology and biotechnological applications. These knowledge gaps include:

  • Regulatory network specificity: While ARE1 regulation by heme, oxygen, and sterol levels has been characterized in S. cerevisiae , the extent to which these regulatory mechanisms are conserved in S. bayanus remains poorly defined. Particularly, the roles of transcription factors like HAP1 and ROX1 in S. bayanus ARE1 regulation require further investigation.

  • Substrate specificity determinants: The molecular basis for substrate preferences of S. bayanus ARE1 remains unclear. While heterologous expression studies suggest preferential acylation of lanosterol , the specific protein domains and amino acid residues responsible for this specificity have not been fully elucidated through structure-function analyses.

  • Physiological significance during fermentation: Although S. bayanus shows distinct fermentation behaviors in mixed cultures , the direct contribution of ARE1 to these phenotypes has not been systematically investigated through gene knockout or overexpression studies under industrial fermentation conditions.

  • Interspecies interactions: The role of ARE1 in mediating interactions between different Saccharomyces species during mixed fermentations remains largely unexplored, particularly how differential sterol metabolism might contribute to competition or cooperation between species.

  • Post-translational regulation: While transcriptional control of ARE1 has received attention, potential post-translational modifications, protein-protein interactions, and subcellular localization dynamics that might regulate ARE1 activity remain understudied.

Addressing these knowledge gaps will require integrative approaches combining genetics, biochemistry, systems biology, and industrial fermentation studies. Particular emphasis should be placed on developing S. bayanus-specific genetic tools and standardized fermentation models that can isolate ARE1 contributions to complex phenotypes.

How should future research on S. bayanus ARE1 be prioritized to maximize both scientific and practical impacts?

Future research on S. bayanus ARE1 should be strategically prioritized to address fundamental knowledge gaps while simultaneously advancing practical applications. A balanced approach should encompass:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.