Recombinant Saccharomyces cerevisiae 30 kDa heat shock protein (HSP30)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
HSP30; YCR021C; YCR21C; 30 kDa heat shock protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
HSP30
Target Protein Sequence
MNDTLSSFLNRNEALGLNPPHGLDMHITKRGSDWLWAVFAVFGFILLCYVVMFFIAENKG SRLTRYALAPAFLITFFEFFAFFTYASDLGWTGVQAEFNHVKVSKSITGEVPGIRQIFYS KYIAWFLSWPCLLFLIELAASTTGENDDISALDMVHSLLIQIVGTLFWVVSLLVGSLIKS TYKWGYYTIGAVAMLVTQGVICQRQFFNLKTRGFNALMLCTCMVIVWLYFICWGLSDGGN RIQPDGEAIFYGVLDLCVFAIYPCYLLIAVSRDGKLPRLSLTGGFSHHHATDDVEDAAPE TKEAVPESPRASGETAIHEPEPEAEQAVEDTA
Uniprot No.

Target Background

Function
This protein likely collaborates with other heat shock proteins in the translocation of polypeptides through membranes. It may counteract the effects of heat shock on the plasma membrane.
Gene References Into Functions
  1. N-glycosylation is induced at Asn(2) of Hsp30p by severe heat shock, ethanol stress, and acetic acid stress. PMID: 22405770
  2. Sfl1p is a key component of the transcriptional control of the stress responsive gene HSP30. PMID: 17594096
Database Links

KEGG: sce:YCR021C

STRING: 4932.YCR021C

Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is HSP30 and where is it localized in Saccharomyces cerevisiae?

HSP30 is a 30 kDa heat shock protein that serves as the single integral plasma membrane heat shock protein in Saccharomyces cerevisiae. It consists of 332 amino acids and is encoded by the HSP30 gene (also known as YCR021C or YCR21C) . As an integral membrane protein, HSP30 is embedded in the plasma membrane of yeast cells, where it plays a crucial role in stress response and adaptation .

To study the localization of HSP30, researchers typically use:

  • GFP-tagging of HSP30 followed by fluorescence microscopy

  • Subcellular fractionation and Western blotting with anti-HSP30 antibodies

  • Immunogold electron microscopy with HSP30-specific antibodies

What environmental conditions induce HSP30 expression?

HSP30 expression is induced by multiple environmental stressors. Based on research findings, the primary conditions that trigger HSP30 expression include:

Stress ConditionRelative Induction LevelTime Course
Heat shockHighRapid induction
Ethanol exposureHighWithin 30-60 minutes
Weak organic acid exposureHighWithin 30-60 minutes
Severe osmostressModerateGradual induction
Glucose limitationModerateDuring diauxic shift

HSP30 is most strongly induced by heat shock, ethanol, and weak organic acid exposure . Unlike many other stress-responsive genes, HSP30 shows a unique induction pattern, responding to some but not all STRE-inducing stresses .

To monitor HSP30 expression experimentally, researchers commonly use Northern blotting or RT-qPCR to measure HSP30 mRNA levels, Western blotting to detect HSP30 protein levels, and HSP30 promoter-reporter fusions to visualize expression patterns.

How does HSP30 differ from other heat shock proteins in yeast?

HSP30 differs from other heat shock proteins (HSPs) in yeast in several important aspects:

CharacteristicHSP30Other Major HSPs
Cellular locationPlasma membraneCytosolic, ER, mitochondrial
Transcriptional regulationNeither HSE nor STRE-dependentHSE-dependent (e.g., HSP70, HSP90) or STRE-dependent
Primary functionDownregulates H+-ATPase activityProtein folding, refolding, and degradation
Molecular structureIntegral membrane proteinTypically soluble proteins
ATP requirementNot an ATPaseMany are ATP-dependent chaperones

Unlike most other HSPs that function as molecular chaperones to assist protein folding, HSP30 appears to serve a specialized function in energy conservation during stress conditions by regulating plasma membrane H+-ATPase activity . This unique function makes HSP30 distinct among the HSP family in yeast.

What are the phenotypic effects of HSP30 deletion in yeast?

Deletion of HSP30 (hsp30Δ) leads to several measurable phenotypes that provide insight into its cellular functions:

PhenotypeEffect in hsp30ΔExperimental Method
ThermotoleranceIncreased sensitivity to lethal heat stress (50°C)Viability assays after heat shock
Growth adaptationExtended adaptation time under stress conditionsGrowth curve analysis
Biomass yieldLower final biomass in culturesDry weight measurements
ATP levelsLower ATP levels, especially at diauxic shiftLuminescence-based ATP assays
H+-ATPase activityHigher H+-ATPase activity during stressEnzyme activity assays
Weak acid toleranceDefective adaptation to growth in weak acidsGrowth assays with organic acids

Interestingly, while HSP30 deletion does not significantly affect general stress tolerance, it specifically impairs the ability of cells to adapt to conditions that demand high energy usage for maintaining homeostasis . This supports the proposed role of HSP30 in energy conservation during stress.

What is the mechanism by which HSP30 downregulates plasma membrane H+-ATPase activity?

The mechanism by which HSP30 downregulates plasma membrane H+-ATPase (Pma1p) activity involves several molecular interactions, although the complete pathway remains under investigation:

Current Understanding of the Mechanism:

  • Direct Interaction Model: HSP30 may physically interact with Pma1p, altering its conformation or affecting its oligomerization state. This interaction could potentially stabilize Pma1p in a lower activity state or interfere with ATP binding or hydrolysis.

  • Lipid Environment Model: As an integral membrane protein, HSP30 may modify the local lipid environment surrounding Pma1p, which is known to be sensitive to membrane composition and fluidity .

  • Signaling Pathway Model: HSP30 might initiate or participate in a signaling cascade that results in post-translational modifications of Pma1p (such as phosphorylation/dephosphorylation), which regulate its activity.

The available evidence indicates that HSP30-mediated downregulation of H+-ATPase is particularly important when cells face energy-demanding stresses, suggesting that this mechanism has evolved as an energy conservation strategy during challenging environmental conditions .

How does HSP30 affect ATP consumption and energy conservation during stress conditions?

HSP30's role in ATP consumption and energy conservation during stress conditions represents a sophisticated adaptation mechanism in yeast:

ATP Conservation Pathway:

  • Under stress conditions (heat, weak acids, ethanol), plasma membrane H+-ATPase (Pma1p) is activated to maintain intracellular pH and ion homeostasis

  • Pma1p activation dramatically increases cellular ATP consumption (can account for up to 20-50% of total ATP usage)

  • HSP30 expression is induced by the same stresses

  • HSP30 downregulates the stress-activated Pma1p activity

  • This downregulation restricts excessive ATP consumption

  • Conserved ATP can be redirected to other essential stress-response processes

Experimental Evidence:

ParameterWild-typehsp30ΔExperimental Method
H+-ATPase activity after heat shockModerate increaseSignificant increaseEnzyme activity assays
ATP levels during diauxic shiftMaintainedDecreasedLuciferase-based ATP assays
Biomass yieldHigherLowerDry weight measurements
Adaptation time to stressShorterLongerGrowth curve analysis

These findings suggest that HSP30 functions as an energy conservation mechanism that becomes critical when cells face prolonged stress or energy-limited conditions . The hsp30Δ strains show higher H+-ATPase activity, lower cellular ATP levels, reduced biomass yields, and extended adaptation periods to stressful conditions.

This energy conservation function appears to be particularly important during weak organic acid stress and the diauxic shift, when glucose becomes limiting and cells transition to alternative carbon source metabolism .

What transcription factors or regulatory elements control HSP30 expression if not the conventional HSE or STRE pathways?

The regulation of HSP30 represents an intriguing case in yeast gene expression, as it does not follow the well-characterized heat shock element (HSE) or stress response element (STRE) pathways:

Experimental Evidence for Unique Regulation:

  • The HSP30 promoter has no good agreement to the HSE consensus sequence

  • HSP30 stress activation is unaffected by a mutation (hsf1-m3) that causes defective heat shock activation of Hsf1-dependent genes

  • HSP30 is activated by some, but not all, STRE-inducing stresses

  • HSP30 activation is largely unaffected by loss of the Msn2/Msn4 transcription factors

  • Mutation of all STRE-like sequences of the promoter does not prevent stress activation

Potential Alternative Regulatory Mechanisms:

Possible MechanismEvidenceExperimental Approach
Novel stress-responsive elementHSP30 activation pattern differs from known pathwaysPromoter deletion/mutation analysis
Unidentified transcription factorNot dependent on Hsf1 or Msn2/4Transcription factor screening
Chromatin remodelingStress may alter chromatin accessibilityChromatin immunoprecipitation, ATAC-seq
Post-transcriptional regulationmRNA stability might be regulated by stressmRNA half-life measurements
Membrane fluidity sensingHSP30 expression correlates with membrane changesManipulation of membrane composition

Research suggests that HSP30 activation "appears to involve as yet unidentified components of the yeast transcriptional apparatus" . This regulatory mystery presents an opportunity for discovering novel stress-responsive transcriptional mechanisms in yeast.

How does HSP30 interact with other stress response pathways in yeast?

HSP30 functions within a complex network of stress response pathways in yeast, with various interactions and interconnections:

Interactions with Major Stress Response Pathways:

Understanding these pathway interactions provides insight into how yeast cells coordinate multiple stress response mechanisms to achieve optimal adaptation and survival.

What methodologies are most effective for studying HSP30 function in experimental settings?

To effectively study HSP30 function in experimental settings, researchers should consider the following methodological approaches:

Genetic Manipulation Techniques:

  • CRISPR/Cas9 Gene Editing:

    • For precise modification of HSP30 gene sequences

    • Creation of point mutations in functional domains

    • Introduction of reporter tags (GFP, HA, His) for detection

  • Promoter Replacement:

    • Substituting the native HSP30 promoter with controllable promoters

    • Allows for inducible or constitutive expression independent of stress

Functional Analysis Methods:

  • H+-ATPase Activity Assays:

    • Isolation of plasma membrane fractions

    • Measurement of ATP hydrolysis and proton pumping activities

    • Comparison between wild-type and HSP30 mutant strains under various stress conditions

  • Bioenergetic Analysis:

    • Real-time measurement of cellular respiration and ATP production

    • Monitoring energy parameters during stress conditions

    • Quantification of energy allocation to different cellular processes

Protein-Protein Interaction Studies:

  • Membrane-Based Two-Hybrid Systems:

    • Split-ubiquitin yeast two-hybrid specifically designed for membrane proteins

    • Identification of protein interactions in native membrane environment

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusions to HSP30 to identify proximal proteins

    • Mass spectrometry identification of the HSP30 interaction network

These methodological approaches allow for comprehensive investigation of HSP30 function, providing insights into its role in stress response and energy conservation in yeast.

What are the optimal conditions for recombinant expression and purification of HSP30?

For optimal recombinant expression and purification of HSP30, researchers should consider the following protocol:

Expression System Selection:

E. coli is the most commonly used expression system for recombinant HSP30, with the following specifications:

  • Vector: pET series vectors with T7 promoter

  • Host strain: BL21(DE3) or Rosetta for improved expression of eukaryotic proteins

  • Fusion tag: N-terminal His-tag for affinity purification

Expression Conditions:

ParameterOptimal ConditionNotes
Induction temperature16-18°CLower temperatures reduce inclusion body formation
Induction duration12-16 hoursExtended time improves yield of properly folded protein
IPTG concentration0.1-0.5 mMLower concentrations promote proper folding
Media additives1% glucoseSuppresses leaky expression prior to induction

Purification Protocol:

  • Cell lysis in buffer containing detergents suitable for membrane proteins

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or CHAPS)

  • Nickel affinity chromatography under non-denaturing conditions

  • Size exclusion chromatography for further purification

  • Storage in buffer containing 6% trehalose at pH 8.0

The purified recombinant HSP30 should show greater than 90% purity as determined by SDS-PAGE .

How can researchers verify the functional activity of recombinant HSP30?

Verifying the functional activity of recombinant HSP30 is essential for research applications. Several complementary approaches can be employed:

In vitro Functional Assays:

  • H+-ATPase Regulation Assay:

    • Co-reconstitution of purified HSP30 and Pma1p into liposomes

    • Measurement of ATP hydrolysis rates with and without HSP30

    • Determination of dose-dependent inhibitory effects

  • Membrane Integration Assessment:

    • Proteoliposome incorporation efficiency

    • Protease protection assays to verify proper membrane topology

    • Circular dichroism spectroscopy to confirm secondary structure

Cellular Functional Verification:

  • Complementation Studies:

    • Expression of recombinant HSP30 in hsp30Δ yeast strains

    • Measurement of restored phenotypes (ATP levels, growth characteristics)

    • Quantification of H+-ATPase activity regulation

  • Stress Response Assays:

    • Heat shock survival rates in complemented strains

    • Adaptation to weak organic acids

    • Recovery from glucose limitation

These methodological approaches provide multiple lines of evidence for the functional integrity of recombinant HSP30, ensuring reliable experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.