Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH2 (IZH2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Homeostasis

IZH2 integrates extracellular signals to maintain cellular equilibrium under varying zinc concentrations and metabolic conditions:

  • Zinc Homeostasis:

    • Regulates intracellular zinc levels via the Rim101 pathway, which is critical in neutral/acidic environments .

    • Phosphatidylinositol metabolism is modulated under zinc-limited conditions to supply inositol .

  • Lipid Metabolism:

    • Directly influences phospholipid balance, linking zinc availability to membrane integrity .

  • pH Regulation:

    • Maintains cytosolic pH through interactions with proton pumps and ion transporters .

Signaling Pathways and Molecular Interactions

IZH2 activates conserved pathways analogous to mammalian AdipoR1/AdipoR2 (Figure 1) :

Key Pathway Components

ComponentRole
RAS2-cAMPMediates PKA activation upon IZH2-osmotin interaction
Snf1p (AMPK homolog)Phosphorylated via IZH2-dependent signaling, regulating stress responses
Sip3 (APPL1 homolog)Facilitates IZH2 interaction with downstream effectors
  • Downstream Effects:

    • Stress Response: Suppresses STRE-dependent transcription under osmotic stress .

    • ROS Modulation: Increases reactive oxygen species (ROS) via PKA activation .

    • Iron Metabolism: Represses FET3 transcription through MSN2/4 transcription factors .

Research Applications and Experimental Findings

Recombinant IZH2 has been pivotal in elucidating conserved adiponectin receptor mechanisms:

A. Split Luciferase Assay

  • AdipoR1-APPL1 Interaction: IZH2’s interaction with APPL1 homolog Sip3 was validated using a split firefly luciferase system .

    • Luciferase activity increased dose-dependently with galactose-induced expression (1.5% galactose: 4.5-fold increase) .

    • Osmotin (a ligand) enhanced luciferase activity by 2.3-fold .

B. Snf1p Phosphorylation Studies

  • IZH2 Deletion Mutants: Showed reduced Snf1p phosphorylation (Thr-172) upon osmotin treatment, confirming IZH2’s role in AMPK pathway activation .

C. Transcriptomic Profiling

  • Gene Knockout Effects: ΔIZH2 strains exhibited altered expression of 127 genes involved in zinc transport, lipid synthesis, and pH regulation .

Production and Availability

Recombinant IZH2 is commercially available for research purposes:

Product CodeSourceSpeciesTagLength
RFL16248SFE. coliS. cerevisiaeHis1–317

Source: Creative BioMart

Implications for Disease Research

  • Diabetes: IZH2’s role in zinc-lipid homeostasis provides insights into insulin resistance mechanisms .

  • Atherosclerosis: PKA-mediated ROS reduction parallels adiponectin’s anti-inflammatory effects in mammals .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order remarks. We will prepare the product according to your demand.
Lead Time
The delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as extra fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
IZH2; PHO36; YOL002C; UND327; ADIPOR-like receptor IZH2; Phosphate metabolism protein 36
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
IZH2
Target Protein Sequence
MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYV KETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDL FYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLF CLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIW TQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGL LNSYELVHIKMENGIVS
Uniprot No.

Target Background

Function
IZH2, a probable receptor, plays a crucial role in metabolic pathways that regulate lipid metabolism, particularly fatty acid oxidation.
Gene References Into Functions
  1. Research has shown that the yeast Izh2 protein is involved in zinc ion homeostasis and the regulation of lipid and phosphate metabolism. PMID: 26067383
  2. Double disruption of the EOS1 and IZH2 genes resulted in a slow-growth phenotype, indicating that the two proteins are involved in related cellular processes. PMID: 20146743
  3. Data suggests that the protein encoded by ORE20/PHO36 (YOL002c) is an osmotin binding plasma membrane protein essential for full sensitivity to osmotin. PMID: 15664187
  4. Studies have demonstrated that overproduction of Izh2p inhibits the iron-dependent induction of the Fet3p component of the high-affinity iron-uptake system and negatively impacts growth in iron-limited medium. PMID: 17553578
  5. Izh2p negatively regulates functionally diverse genes through a CCCTC promoter motif. PMID: 18625204
  6. Izh2p produces sphingoid bases, bioactive lipids that likely serve as the second messenger responsible for the repressive effect of Izh2p on iron-uptake gene FET3. PMID: 19066337

Show More

Hide All

Database Links

KEGG: sce:YOL002C

STRING: 4932.YOL002C

Protein Families
ADIPOR family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is IZH2 and what is its significance in Saccharomyces cerevisiae?

IZH2 is a Zap1-regulated gene in Saccharomyces cerevisiae that encodes an ADIPOR-like receptor. The protein functions in cellular processes related to zinc homeostasis and oxidative stress response pathways. Research indicates that IZH2 can suppress the hydrogen peroxide-sensitive eos1 mutation when overexpressed from a plasmid, suggesting its role in stress tolerance mechanisms .

The significance of IZH2 in yeast biology stems from its involvement in multiple cellular processes, including zinc signaling pathways, membrane integrity, and oxidative stress response. Understanding IZH2 function provides insights into fundamental cellular adaptation mechanisms that may be conserved across species.

How does IZH2 interact with the EOS1 gene in yeast cells?

While IZH2 and EOS1 do not appear to be functionally interchangeable, experimental evidence shows significant interaction between these genes. When IZH2 is overexpressed, it can suppress the hydrogen peroxide sensitivity phenotype of eos1 mutants . This suppression mechanism suggests a functional relationship in oxidative stress tolerance pathways.

The relationship between these genes is further evidenced by growth phenotypes in double-knockout strains. Double disruption of EOS1 and IZH2 genes yields a slow-growth phenotype, strongly suggesting that the two proteins are involved in related cellular processes . This genetic interaction provides a valuable experimental model for studying redundancy and complementation in stress response systems.

What experimental methods are best suited for initial characterization of IZH2 function?

For researchers beginning work with IZH2, a systematic approach using the following methods is recommended:

  • Gene expression analysis using RT-qPCR to establish baseline expression patterns under various conditions

  • Phenotypic screening of IZH2 knockout strains under different stress conditions (oxidative, osmotic, metal toxicity)

  • Protein localization studies using fluorescent protein tags to determine subcellular distribution

  • Growth assays comparing wild-type, IZH2 mutant, and EOS1 mutant strains under various stress conditions

These methodologies establish foundational knowledge about IZH2 before proceeding to more complex functional studies. When designing these experiments, ensure proper controls are included, such as housekeeping genes for expression studies and multiple stress conditions to determine specificity of response pathways.

How can I design experiments to investigate IZH2's role in zinc homeostasis?

Given the relationship between IZH2 and zinc regulation, robust experimental designs should incorporate the following elements:

  • Variable manipulation: Systematically alter zinc concentrations in growth media while monitoring IZH2 expression and cellular phenotypes . Test both zinc-depleted and zinc-excess conditions.

  • Experimental treatments: Design treatments that include:

    • Wild-type cells in varying zinc concentrations

    • IZH2 knockout cells in varying zinc concentrations

    • IZH2 overexpression strains in varying zinc concentrations

    • ZAP1 knockout strains (to disconnect zinc regulatory networks)

  • Dependent variables to measure:

    • Intracellular zinc levels using zinc-specific fluorescent probes

    • IZH2 expression levels (mRNA and protein)

    • Expression of known zinc-responsive genes

    • Growth rates and cellular morphology

  • Extraneous variable control: Maintain consistent media composition except for zinc, control temperature and growth phase, and use biological replicates to account for strain variation .

Experimental ConditionWild-typeIZH2 KnockoutIZH2 Overexpression
Zinc-depleted mediaBaseline growthHypothesized growth defectPotential rescue
Normal zinc mediaNormal growthMild phenotypeEnhanced zinc uptake
Zinc-excess mediaGrowth inhibitionPotential resistancePotential toxicity

This experimental matrix allows for comprehensive assessment of IZH2's role across the full spectrum of zinc availability conditions.

What approaches should be used to study the genetic interaction between IZH2 and EOS1?

To thoroughly characterize the genetic interaction between IZH2 and EOS1, implement a multi-faceted approach:

  • Epistasis analysis: Create single and double knockout strains (Δizh2, Δeos1, and Δizh2Δeos1) and characterize their phenotypes under oxidative stress conditions. The observed slow-growth phenotype in double mutants suggests synergistic rather than redundant functions .

  • Complementation experiments: Perform cross-complementation by expressing IZH2 in Δeos1 strains and EOS1 in Δizh2 strains to determine functional overlap. Based on previous findings, IZH2 overexpression can rescue some eos1 mutant phenotypes .

  • Transcriptomic profiling: Conduct RNA-Seq analysis comparing wild-type, single mutants, and double mutants to identify differentially expressed genes. Previous microarray analysis revealed decreased expression of Zap1-regulated genes in the eos1-deletion mutant , suggesting similar approaches would be informative for IZH2.

  • Protein-protein interaction studies: Implement co-immunoprecipitation or yeast two-hybrid assays to determine if IZH2 and EOS1 physically interact or exist in the same protein complexes.

These approaches should be performed under both standard growth conditions and various stress conditions (particularly oxidative stress and altered zinc concentrations) to fully map the functional relationship between these genes.

How can contradictory data about IZH2 function be reconciled and validated?

When facing contradictory results regarding IZH2 function, implement the following validation framework:

  • Identify the contradiction type: Determine whether the contradictions are:

    • Self-contradictory findings within a single study

    • Contradicting findings between different studies

    • Conditional contradictions where results depend on specific experimental parameters

  • Methodological assessment:

    • Evaluate experimental designs for confounding variables

    • Compare strain backgrounds, as different yeast strains may exhibit different IZH2 dependencies

    • Assess growth conditions, media compositions, and stress parameters

    • Review statistical approaches and sample sizes

  • Replication strategy:

    • Design validation experiments that directly test contradictory findings

    • Include positive and negative controls explicitly targeting the contradiction

    • Implement blinded analysis of results

    • Conduct dose-response experiments rather than single-point measurements

  • Integrative analysis:

    • Employ multiple complementary techniques to measure the same outcome

    • Correlate phenotypic observations with molecular data

    • Consider time-dependent factors that might explain apparent contradictions

When contradictions persist despite these approaches, consider the possibility that both findings are correct under specific conditions, suggesting context-dependent functions of IZH2 that may reveal new aspects of its biological role.

What techniques can be used to analyze IZH2 protein structure-function relationships?

To establish structure-function relationships for the IZH2 protein, employ these advanced methodological approaches:

  • Systematic mutagenesis:

    • Create a library of single amino acid substitutions throughout the IZH2 sequence

    • Focus on conserved domains shared with other ADIPOR-like receptors

    • Use site-directed mutagenesis to target predicted functional sites

  • Domain swap experiments:

    • Create chimeric proteins between IZH2 and related proteins (IZH1, IZH3, or IZH4)

    • Express mammalian ADIPOR proteins in Δizh2 yeast to test functional conservation

  • Structural biology approaches:

    • Implement crystallography or cryo-EM for structure determination

    • Use computational modeling based on homology with known ADIPOR structures

    • Validate models through targeted mutagenesis of predicted structural elements

  • Functional assays for structure-function correlation:

    • Measure protein-protein interactions for wild-type and mutant variants

    • Assess membrane localization of mutant proteins

    • Quantify zinc binding capacity of purified protein domains

    • Test stress response restoration in deletion strains complemented with mutant variants

Results from these experiments can be organized into functional maps correlating specific protein regions with distinct functions, providing insights into the molecular mechanisms of IZH2 action.

How should I design experiments to study IZH2 in relation to oxidative stress response?

When investigating IZH2's role in oxidative stress, implement an experimental design that controls for confounding variables while systematically varying stress conditions:

  • Experimental variables:

    • Independent variables: Type of oxidative stressor (H₂O₂, menadione, paraquat), stressor concentration, exposure time

    • Dependent variables: Cell viability, growth rate, gene expression changes, protein oxidation levels

    • Control variables: Growth phase, media composition, temperature, cell density

  • Strain preparation:

    • Wild-type control

    • IZH2 knockout

    • IZH2 overexpression

    • EOS1 knockout (as comparative control)

    • IZH2/EOS1 double knockout

  • Treatment matrix:

Strain TypeNo StressLow H₂O₂High H₂O₂MenadioneParaquat
Wild-typeBaselineResponse 1Response 2Response 3Response 4
ΔIZH2Effect 1Effect 2Effect 3Effect 4Effect 5
IZH2-OEEffect 6Effect 7Effect 8Effect 9Effect 10
ΔEOS1Effect 11Effect 12Effect 13Effect 14Effect 15
ΔIZH2ΔEOS1Effect 16Effect 17Effect 18Effect 19Effect 20
  • Experimental workflow:

    • Culture cells to mid-log phase under identical conditions

    • Apply oxidative stressors at defined concentrations

    • Sample at multiple time points (0, 15, 30, 60, 120 minutes)

    • Measure multiple outcomes (growth, viability, gene expression)

    • Include technical and biological replicates (minimum n=3)

This comprehensive design allows for isolation of IZH2-specific effects while controlling for variables that might confound interpretation. The inclusion of multiple stressors helps distinguish general oxidative stress responses from specific IZH2-mediated pathways.

What methods are most effective for analyzing changes in IZH2 expression under different environmental conditions?

To accurately measure IZH2 expression changes, implement a multi-level analysis strategy:

  • Transcriptional analysis:

    • RT-qPCR with carefully selected reference genes stable under experimental conditions

    • RNA-Seq for genome-wide context of expression changes

    • Reporter gene assays (e.g., IZH2 promoter driving GFP/luciferase) for real-time monitoring

  • Translational analysis:

    • Western blotting with specific antibodies (or epitope-tagged IZH2)

    • Polysome profiling to assess translation efficiency

    • IRES-dependent translation analysis using dual-luciferase reporters if IRES elements are present

  • Environmental conditions to test:

    • Varying zinc concentrations (deficiency, sufficiency, excess)

    • Oxidative stress inducers

    • Nutrient limitation

    • Growth phase transitions

    • Temperature variations

  • Data normalization and analysis:

    • Use multiple reference genes for RT-qPCR normalization

    • Implement appropriate statistical tests based on data distribution

    • Consider time-course analysis rather than single time points

    • Correlate expression changes with phenotypic outcomes

This multi-faceted approach provides robust data on how IZH2 expression responds to environmental perturbations, while controlling for technical and biological variability that might otherwise lead to inconsistent results.

How can I analyze contradictory results in IZH2 research and identify potential sources of experimental variation?

When encountering contradictory results in IZH2 research, implement this systematic analysis approach:

  • Contradiction categorization:

    • Identify whether contradictions exist within your own experiments or between your results and published literature

    • Classify contradictions as quantitative (different magnitudes of the same effect) or qualitative (opposite effects)

  • Experimental parameter comparison:

    • Create a detailed comparison table of all experimental parameters:

ParameterExperiment AExperiment BPotential Impact
Yeast strain backgroundBY4741W303Different genetic backgrounds may have varying IZH2 dependencies
Media compositionYPDSynthetic completeNutrient availability affects zinc homeostasis
Growth phaseLog phaseStationary phaseIZH2 function may be growth-phase dependent
Stress exposure time30 minutes2 hoursAcute vs. chronic responses may differ
Temperature30°C25°CMembrane fluidity affects receptor function
Gene deletion methodCRISPRHomologous recombinationDifferent potential for off-target effects
  • Statistical reanalysis:

    • Evaluate statistical power in both experiments

    • Consider effect sizes rather than just p-values

    • Test for batch effects or other hidden variables

    • Implement meta-analysis techniques if multiple studies exist

  • Reconciliation experiments:

    • Design experiments that specifically test the conditions under which each contradictory result was obtained

    • Include intermediate conditions to identify transition points

    • Consider genetic background effects by testing in multiple strain backgrounds

By systematically analyzing experimental differences, you can often identify conditional factors that explain apparent contradictions, potentially revealing new insights about context-dependent IZH2 functions.

What are the best approaches for integrating transcriptomic and phenotypic data in IZH2 research?

To effectively integrate transcriptomic and phenotypic data for comprehensive understanding of IZH2 function:

  • Synchronized experimental design:

    • Collect transcriptomic and phenotypic data from the same experimental samples

    • Implement time-course sampling to capture dynamic relationships

    • Include multiple stress conditions and genetic backgrounds

  • Correlation analysis framework:

    • Calculate correlation coefficients between gene expression patterns and phenotypic measurements

    • Implement hierarchical clustering to identify genes with expression patterns similar to observed phenotypes

    • Use principal component analysis to identify major sources of variation across datasets

  • Pathway-focused integration:

    • Map differentially expressed genes to known pathways (zinc homeostasis, stress response, membrane integrity)

    • Calculate pathway enrichment scores and correlate with phenotypic outcomes

    • Identify transcriptional regulators upstream of coordinated expression changes

  • Network analysis:

    • Construct gene regulatory networks centered on IZH2

    • Identify hub genes that may mediate between IZH2 expression and phenotypic outcomes

    • Predict functional relationships based on network topology

  • Validation experiments:

    • Test predicted relationships through targeted gene deletions or overexpressions

    • Use genetic epistasis experiments to confirm pathway relationships

    • Implement external perturbations to test network resilience

This integrated approach provides a systems-level understanding of how IZH2-mediated transcriptional changes relate to observed phenotypes, potentially revealing indirect mechanisms and regulatory relationships not apparent from either dataset alone.

What are the best methods for creating and validating recombinant IZH2 expression systems?

To develop reliable recombinant IZH2 expression systems, follow these methodological guidelines:

  • Expression system selection:

    • Homologous expression: Use S. cerevisiae with inducible promoters (GAL1, CUP1) for native folding and processing

    • Heterologous expression: Consider E. coli (for protein purification), mammalian cells (for functional studies of membrane localization), or Pichia pastoris (for high-yield expression of membrane proteins)

  • Construct design considerations:

    • Include appropriate epitope tags (HA, FLAG, His) for detection and purification

    • Consider fluorescent protein fusions for localization studies

    • Design constructs with appropriate regulatory elements for the chosen expression system

    • Include proper signal sequences if needed for membrane targeting

  • Expression validation protocol:

    • Transcriptional validation: RT-qPCR to confirm mRNA expression

    • Translational validation: Western blot analysis with tag-specific or IZH2-specific antibodies

    • Functional validation: Complementation of IZH2 knockout phenotypes

    • Localization validation: Microscopy or subcellular fractionation to confirm proper membrane targeting

  • Optimization strategies:

    • Test multiple promoter strengths to achieve desired expression levels

    • Optimize codon usage for the expression host if using heterologous systems

    • Test expression at different temperatures to improve folding

    • Consider fusion partners that enhance stability or solubility

Careful validation across multiple levels ensures that the recombinant IZH2 not only expresses at the desired level but also folds correctly and maintains functional activity, providing a reliable tool for subsequent experiments.

How can I implement quantitative methods to measure IZH2 interactions with other cellular components?

To quantitatively assess IZH2 interactions with other cellular components, employ these advanced methodological approaches:

  • Protein-protein interaction quantification:

    • Co-immunoprecipitation with quantitative western blotting: Use serial dilutions of input and immunoprecipitated samples for quantification

    • FRET/BRET assays: Implement fluorescence or bioluminescence resonance energy transfer for real-time interaction monitoring

    • Split-reporter systems: Use split-luciferase or split-GFP to visualize and quantify interactions in vivo

    • Surface plasmon resonance: For purified components, measure binding kinetics and affinity constants

  • Membrane dynamics analysis:

    • FRAP (Fluorescence Recovery After Photobleaching): Measure IZH2 mobility within membranes

    • Single-particle tracking: Follow individual IZH2 molecules to assess clustering and diffusion rates

    • Lipidomic analysis: Quantify changes in membrane lipid composition in response to IZH2 manipulation

  • Metabolic interaction measurement:

    • Metabolomics profiling: Compare metabolite levels between wild-type and IZH2 mutant strains

    • Flux analysis: Use isotope labeling to trace metabolic pathways affected by IZH2

    • Zinc transport assays: Measure zinc uptake/efflux rates using zinc-specific fluorescent probes

  • Data integration and modeling:

    • Implement Bayesian networks to integrate multiple interaction datasets

    • Develop quantitative models of IZH2-dependent pathways

    • Use machine learning approaches to identify patterns in complex interaction data

These quantitative approaches provide precise measurements of IZH2 interactions that can be used to build mathematical models of IZH2 function and to identify critical parameters that determine its role in cellular processes.

What emerging technologies could advance our understanding of IZH2 function in yeast?

Several cutting-edge technologies show particular promise for uncovering new aspects of IZH2 biology:

  • CRISPR-based technologies:

    • CRISPRi/CRISPRa: For tunable repression or activation of IZH2 and interacting genes

    • CRISPR screening: Genome-wide screens for synthetic lethality or rescue of IZH2 phenotypes

    • Base editing: For introducing specific point mutations without double-strand breaks

  • Advanced imaging technologies:

    • Super-resolution microscopy: Visualize IZH2 distribution and clustering at nanoscale resolution

    • Live-cell imaging with optogenetics: Control IZH2 activity with light while monitoring cellular responses

    • Correlative light and electron microscopy: Connect IZH2 localization with ultrastructural context

  • Single-cell approaches:

    • Single-cell RNA-seq: Analyze cell-to-cell variation in transcriptional responses to IZH2 perturbation

    • Mass cytometry: Simultaneously measure multiple signaling proteins in individual cells

    • Microfluidic devices: Track individual cell responses to changing environmental conditions

  • Structural biology advances:

    • Cryo-electron microscopy: Determine IZH2 structure in native membrane environment

    • Hydrogen-deuterium exchange mass spectrometry: Map dynamic protein interactions and conformational changes

    • Computational structure prediction: Apply AlphaFold2 and similar approaches to model IZH2 structure and interactions

These technologies can address current knowledge gaps regarding IZH2 function, particularly in understanding its dynamic behavior, structural adaptations to different conditions, and cell-to-cell variability in its activity.

How can evolutionary analysis of IZH2 homologs inform functional studies?

Evolutionary analysis provides valuable context for understanding IZH2 function through these methodological approaches:

  • Comparative genomics workflow:

    • Identify IZH2 orthologs across fungal species and potential homologs in higher eukaryotes

    • Perform multiple sequence alignments to identify conserved domains and residues

    • Calculate selection pressures (dN/dS ratios) across protein regions to identify functionally constrained sites

    • Map conservation patterns onto structural models to predict functional sites

  • Functional divergence analysis:

    • Compare functions of IZH family members (IZH1-4) in S. cerevisiae

    • Test cross-species complementation (can human ADIPOR rescue yeast Δizh2?)

    • Identify lineage-specific adaptations through targeted mutagenesis of divergent residues

  • Domain architecture examination:

    • Analyze acquisition or loss of functional domains across evolutionary time

    • Compare membrane topology predictions across species

    • Identify co-evolving protein partners through mirror-tree analysis

  • Integrative evolutionary approach:

    • Correlate evolutionary conservation with experimental functional data

    • Test evolutionarily informed hypotheses through targeted experiments

    • Develop an evolutionary model for the emergence of IZH2 function in zinc homeostasis

By connecting evolutionary patterns to functional studies, researchers can distinguish core conserved functions of IZH2 from species-specific adaptations, providing context for experimental results and guiding future investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.