Recombinant Saccharomyces cerevisiae ADP,ATP carrier protein 1 (AAC1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Biological Role

AAC1 is one of three ADP/ATP carrier isoforms in S. cerevisiae (AAC1, AAC2, AAC3) encoded by nuclear genes. Key features include:

  • Gene locus: YMR056C (SGD ID: S000004660) .

  • Function: Exchanges cytosolic ADP with mitochondrial ATP, supporting oxidative phosphorylation .

  • Expression: Constitutively expressed under aerobic conditions but repressed during anaerobiosis .

  • Isoform comparison: AAC1 is a minor isoform (~8% of total AAC activity) compared to AAC2, the principal carrier under aerobic growth .

Recombinant Production and Purification

Recombinant AAC1 has been expressed in heterologous systems to study its biochemical properties:

Table 1: Recombinant AAC1 Expression Systems

Host SystemTagConstruct DetailsKey FindingsReference
E. coliN-terminal HisFull-length AAC1 (1–309 aa)Soluble expression achieved; used for structural studies
S. cerevisiaeNoneTruncated variant (Δ1–10)Improved functional complementation in ∆AAC1/∆AAC2 yeast strains
  • Purification: Detergent-solubilized AAC1 is purified via affinity chromatography (e.g., Ni Sepharose) with yields of ~1.3 mg protein per gram of mitochondria .

Table 2: Functional Assays of Recombinant AAC1

Assay TypeSubstrateKey MetricsFindingsReference
Transport kineticsATPApparent Km: ~23.7 µMConsistent with low micromolar affinity for ATP
Inhibitor screeningChebulinic acid, SuraminIC50: 6.0 µM, 2.4 µMPotent inhibition correlates with negative charge density
Complementation∆AAC1/∆AAC2 yeastGrowth on non-fermentable carbon sourcesTruncated AAC1 (Δ1–10) partially restores respiration
  • Oxygen regulation: AAC1 expression is repressed eightfold under anaerobic conditions, independent of heme signaling .

  • Isoform-specific roles: AAC1 supports ATP import into mitochondria under stress (e.g., mitochondrial DNA depletion), albeit less efficiently than AAC2 .

Research Applications

Recombinant AAC1 serves as a model to study:

  • Drug-induced mitochondrial toxicity: Thermostability shift assays identify inhibitors (e.g., CD-437) targeting the substrate-binding site .

  • Evolution of transport mechanisms: Comparative studies with AAC2/AAC3 reveal residues critical for nucleotide specificity .

  • Structural dynamics: Crystallography of homologs (e.g., AAC2/AAC3) informs gating mechanisms involving salt-bridge networks .

Challenges and Future Directions

  • Expression limitations: Full-length AAC1 shows poor solubility in E. coli, necessitating truncation or fusion tags .

  • Functional redundancy: Overlapping roles with AAC2 complicate isoform-specific analyses .

  • Therapeutic potential: Engineered AAC1 variants could optimize ATP/ADP flux in industrial yeast strains for biofuel production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery timelines, please consult your local distributors.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipment is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Typically, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
AAC1; YMR056C; YM9796.09C; ADP,ATP carrier protein 1; ADP/ATP translocase 1; Adenine nucleotide translocator 1; ANT 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
AAC1
Target Protein Sequence
MSHTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGI LDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAG NLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGL YRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGASTASYPLD TVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGVISLYDQLQ LIMFGKKFK
Uniprot No.

Target Background

Function
ADP:ATP antiporter mediates the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating through the alternating access mechanism with a single substrate-binding site alternately exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Gene References Into Functions
  1. AAC contains a cryptic matrix targeting signal that can target up to two thirds of the N-terminal part of the protein to the matrix. This event is coordinated by the TIM23 translocase PMID: 15320873
  2. All Cys residues replacing 9 continuous amino acids in Met310-Lys318 showed high reactivity with eosin 5-maleimde regardless of the presence of carboxyatractyloside or bongkrekate. This region was concluded to be exposed to a water-accessible environment. PMID: 18313366
Database Links

KEGG: sce:YMR056C

STRING: 4932.YMR056C

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the AAC1 protein and what is its role in Saccharomyces cerevisiae?

AAC1 is one of three paralogous proteins (along with AAC2 and AAC3) that function as mitochondrial ADP/ATP carriers in the yeast Saccharomyces cerevisiae. These carriers are integral inner mitochondrial membrane proteins of approximately 300 amino acids that facilitate the exchange of ADP and ATP across the mitochondrial membrane . As a member of the mitochondrial carrier family, AAC1 plays a role in cellular energy metabolism by mediating the exchange of cytosolic ADP for mitochondrially generated ATP, although it exhibits different expression patterns and functional capabilities compared to the other isoforms .

How does the expression pattern of AAC1 differ from other ADP/ATP carrier isoforms?

AAC1 exhibits a distinctive expression pattern compared to its paralogous proteins. Transcription of AAC1 from its native promoter occurs at very low levels in the presence of oxygen (aerobic conditions) and is repressed during anaerobic growth in a heme-independent manner . This pattern contrasts with AAC3, which is reciprocally regulated - oxygen represses the transcription of AAC3. Meanwhile, AAC2 is the most abundantly expressed isoform under normal respiratory growth conditions . This differential regulation suggests evolved roles for each carrier to accommodate specific metabolic conditions within the yeast cell.

What are the key functional differences between AAC1 and other carrier isoforms?

Functional studies have revealed that AAC1 has approximately 25% of the ADP/ATP exchange capability compared to AAC2 . The affinity for binding ADP at the intermembrane space shows differences among the three isoforms, with KD values of 8.8 μM for Aac1, 5.4 μM for Aac2, and 3.4 μM for Aac3 . Importantly, AAC1 exhibits a reduced capacity to support growth of yeast lacking mitochondrial DNA (rho- yeast) or yeast lacking the ATP/Mg-Pi carrier (encoded by SAL1) . Unlike AAC2 and AAC3, AAC1 appears to be deficient in what researchers have termed the "V function" (viability function), which relates to the ability to accumulate ATP in the mitochondrial matrix .

What techniques are most effective for expressing and studying recombinant AAC1?

For expression and study of recombinant AAC1, researchers typically use several complementary approaches. One effective strategy involves expressing the gene from the native AAC2 locus in aac1Δ aac3Δ yeast to ensure physiologically relevant expression levels while eliminating potential confounding effects from the other carrier isoforms . The gene can be amplified using PCR and introduced into appropriate expression vectors. For yeast-based expression systems, strains such as Saccharomyces cerevisiae EBY100 can be employed .

Expression vectors containing the α-mating factor secretion signal (MFα1) can facilitate efficient production and secretion . For detection and purification purposes, epitope tagging approaches such as FLAG-tagging at the C-terminus have proven effective . When higher purity is required, systems utilizing His-tagging (such as N-terminal 10xHis tags) can provide efficient detection and purification through affinity chromatography, with potential to achieve greater than 85% purity as determined by SDS-PAGE .

How can researchers assess the functional capabilities of AAC1 compared to other carrier isoforms?

To assess functional differences between AAC1 and other carrier isoforms, researchers can employ complementation assays in various yeast genetic backgrounds. Key approaches include:

  • Respiration competence assay: Expressing AAC1 in aac2Δ yeast and testing for growth on non-fermentable carbon sources to assess respiratory function .

  • Rho- viability assay: Expressing AAC1 in yeast lacking mitochondrial DNA to evaluate the capacity to support ATP import into mitochondria .

  • sal1Δ complementation assay: Testing the ability of AAC1 to rescue the lethality of sal1Δ aac2Δ double mutants, which requires efficient ATP import into mitochondria .

  • Measurement of nucleotide exchange activities: Direct biochemical assessment of ADP/ATP exchange rates in isolated mitochondria or reconstituted systems .

  • Assessment of growth rates and colony formation: Quantitative analysis of growth rates under various conditions provides a sensitive measure of functional differences .

These complementary approaches allow for comprehensive characterization of the functional capabilities and limitations of AAC1 relative to other carrier isoforms.

What are recommended protocols for purification and structural analysis of AAC1?

For purification and structural analysis of AAC1, researchers should consider the following methodological approach:

  • Expression system selection: Utilizing E. coli expression systems for high-yield production of recombinant protein with appropriate affinity tags, such as N-terminal 10xHis tags .

  • Purification strategy:

    • Initial capture through immobilized metal affinity chromatography (IMAC)

    • Secondary purification via size exclusion or ion exchange chromatography

    • Validation of purity by SDS-PAGE (aiming for >85% purity)

  • Structural preservation: Maintaining the protein in appropriate detergent micelles or nanodiscs to preserve native conformation.

  • Analysis techniques:

    • Circular dichroism (CD) spectroscopy for secondary structure assessment

    • Thermal stability assays to evaluate folding and stability

    • X-ray crystallography or cryo-EM for high-resolution structural determination

    • Nuclear magnetic resonance (NMR) for dynamic structural analysis

  • Quality control: Confirming functional integrity through nucleotide binding assays and reconstitution experiments.

For researchers specifically interested in structural comparisons between AAC1 and other isoforms, chimeric protein approaches have proven particularly informative in identifying functionally important regions .

Which domains of AAC1 are responsible for its distinct functional properties?

Through careful analysis of chimeric proteins containing different combinations of AAC1 and AAC2 sequences, researchers have identified that the C1 and M2 loops of the ADP/ATP carriers contain divergent residues responsible for the functional differences between AAC1 and AAC2 . The study employed a systematic approach creating 16 different chimeric combinations of protein sections, which were then evaluated for their ability to support growth under various conditions.

The four sections analyzed in these chimeric studies were designated as N-term, C1, M2, and C-term . Through complementation assays in various genetic backgrounds, the research conclusively demonstrated that specific divergent residues within the C1 and M2 loops are critical determinants of the functional differences between these carrier isoforms. These regions likely play important roles in nucleotide binding, transport kinetics, or interactions with other proteins that modulate carrier function .

How do specific amino acid substitutions affect AAC1 functionality?

Studies have identified several key amino acid positions that significantly impact the functionality of ADP/ATP carriers. While specific information about AAC1 mutations is limited in the provided search results, research on the Aac2 isoform provides valuable insights that can guide investigation of AAC1.

For example, the R96H mutation in Aac2 significantly alters its functional properties . By extension, equivalent positions in AAC1 may have similar importance. Researchers investigating AAC1 functionality should consider:

  • Conserved charged residues within transmembrane domains that may participate in nucleotide binding

  • Residues in the C1 and M2 loops identified as critical for functional differences between isoforms

  • Positions involved in interdomain interactions that maintain the protein's dynamic structure

To systematically study the effects of amino acid substitutions, site-directed mutagenesis approaches targeting these regions, followed by functional complementation assays in appropriate yeast strains, represent the most informative experimental strategy.

What is the relationship between the structure of AAC1 and its reduced capacity for ATP import?

The reduced capacity of AAC1 for ATP import into mitochondria, particularly evident in its inability to support growth of yeast lacking mitochondrial DNA or the ATP/Mg-Pi carrier (Sal1), appears to be related to specific structural features . While AAC1 retains ADP/ATP exchange capability, it operates at approximately 25% efficiency compared to AAC2 .

This functional difference has been attributed to what researchers term the "V function" (viability function), which relates to ATP accumulation in the mitochondrial matrix . The structural basis for this functional difference has been localized primarily to the C1 and M2 loops through chimeric protein studies.

These regions likely influence:

  • The binding affinity for nucleotides (reflected in the different KD values)

  • The directionality or kinetics of nucleotide exchange

  • Potential interactions with other mitochondrial proteins that modulate carrier function

The molecular details of these structural differences require further investigation through high-resolution structural analyses and targeted functional studies.

How can AAC1 be utilized in studies of mitochondrial bioenergetics?

AAC1 provides a valuable tool for investigating fundamental aspects of mitochondrial bioenergetics, particularly when comparing different modes of ADP/ATP exchange. Researchers can leverage the functional differences between AAC1 and other carrier isoforms to study:

  • Directional preferences in nucleotide exchange: AAC1's reduced capability for supporting ATP import makes it useful for studies distinguishing between import and export processes.

  • Threshold requirements for mitochondrial ATP levels: By expressing AAC1 at different levels, researchers can determine the minimum ATP import capacity required for various mitochondrial functions.

  • Interactions between ADP/ATP carriers and other components of mitochondrial energy metabolism: The differential functionality of AAC1 can reveal dependencies on other transporters or enzymes.

  • Metabolic adaptations to altered nucleotide exchange: Studying cells expressing only AAC1 can reveal compensatory mechanisms that emerge when ATP import is limited.

  • Differential regulation under varying metabolic conditions: AAC1's unique expression pattern makes it suitable for studying adaptive responses to oxygen availability.

These applications make AAC1 a particularly useful experimental tool when contrasted with the more abundant and functionally robust AAC2.

What research strategies can identify interacting partners of AAC1?

To identify proteins that interact with AAC1, researchers should consider implementing multiple complementary approaches:

  • Affinity purification coupled with mass spectrometry:

    • Express epitope-tagged AAC1 (e.g., FLAG-tagged as described in the literature)

    • Perform gentle solubilization of mitochondrial membranes

    • Isolate protein complexes through affinity purification

    • Analyze co-purifying proteins by mass spectrometry

  • Proximity labeling approaches:

    • Fusion of AAC1 with enzymes such as BioID or APEX2

    • In vivo labeling of proximal proteins

    • Isolation and identification of biotinylated proteins

  • Genetic interaction screening:

    • Synthetic genetic array (SGA) analysis with AAC1 mutants

    • Identification of genes showing synthetic growth defects when combined with AAC1 mutations

  • In vitro binding assays:

    • Reconstitution of purified AAC1 in liposomes or nanodiscs

    • Assessment of direct binding to candidate interacting proteins

  • Split-reporter systems:

    • Fusion of AAC1 fragments with split reporter proteins

    • Screening for complementation of reporter activity in the presence of interacting proteins

These approaches can reveal both structural interactors (proteins physically associating with AAC1) and functional interactors (proteins whose functions are coordinated with AAC1 activity).

How does AAC1 function differ in various metabolic conditions?

AAC1 exhibits distinctive functional characteristics under different metabolic conditions, which reflects its evolved role in yeast physiology:

  • Aerobic vs. anaerobic metabolism:
    AAC1 is expressed at very low levels in the presence of oxygen and is repressed during anaerobic growth in a heme-independent manner . This contrasts with AAC3, which is induced under anaerobic conditions, suggesting that AAC1 is primarily adapted for specific aerobic contexts.

  • Fermentative vs. respiratory metabolism:
    While AAC1 can support respiratory growth when expressed from the AAC2 locus, it does so less efficiently than AAC2, particularly evident in its reduced capacity to support growth of yeast lacking mitochondrial DNA . This suggests that AAC1 may be less efficient at supporting ATP import required during non-respiratory conditions.

  • Normal vs. stressed mitochondrial function:
    The inability of AAC1 to effectively compensate for the loss of both Sal1 and Aac2 suggests it is not well-adapted to conditions requiring high rates of ATP import into mitochondria, such as when mitochondrial function is compromised .

These differential functions likely reflect specialized roles that emerged following gene duplication events, allowing yeast to adapt to diverse environmental and metabolic conditions.

How do the functional differences between AAC1, AAC2, and AAC3 reflect their evolutionary history?

The three ADP/ATP carrier isoforms in Saccharomyces cerevisiae likely arose through gene duplication events followed by functional specialization. Their distinct expression patterns and functional capabilities reflect adaptation to different metabolic conditions:

IsoformExpression PatternADP/ATP Exchange CapabilityKD for ADP BindingSupport for rho- GrowthSupport for sal1Δ Viability
AAC1Low in aerobic, repressed in anaerobic~25% of AAC28.8 μMPoorPoor
AAC2Predominant in respiratory growth100% (reference)5.4 μMGoodGood
AAC3Repressed by oxygen, induced in anaerobicSimilar to AAC23.4 μMModerateModerate

This functional divergence suggests that AAC2 has become the predominant carrier for general respiratory metabolism, while AAC1 and AAC3 have evolved more specialized roles . AAC3's induction under anaerobic conditions suggests adaptation to facilitate ATP import during fermentative growth, while AAC1's more limited capability and unusual expression pattern may reflect adaptation to specific physiological contexts or stresses not captured in standard laboratory conditions.

The differences in nucleotide binding affinities (reflected in the KD values) further support this specialization hypothesis, with AAC3 showing the highest affinity for ADP, consistent with its proposed role in ATP uptake during anaerobic growth .

What methodological approaches are most effective for functional comparison between AAC isoforms?

For rigorous functional comparison between AAC isoforms, researchers should implement a multi-faceted approach:

  • Expression normalization:

    • Expression of all isoforms from the same genomic locus (e.g., the native AAC2 locus)

    • Verification of comparable protein expression levels through Western blotting

    • Use of identical epitope tags to ensure consistent detection

  • Growth phenotype analysis:

    • Quantitative growth measurements under various carbon sources

    • Assessment of ability to support growth of rho- yeast

    • Complementation of sal1Δ aac2Δ synthetic lethality

  • Biochemical characterization:

    • Isolation of mitochondria from yeast expressing different isoforms

    • Direct measurement of ADP/ATP exchange rates

    • Determination of nucleotide binding affinities

  • Chimeric protein analysis:

    • Systematic construction of chimeric proteins exchanging domains between isoforms

    • Identification of critical regions responsible for functional differences

  • Mutational analysis:

    • Targeted mutagenesis of residues differing between isoforms

    • Selection for suppressors of functional deficiencies

This integrated approach has proven particularly effective in defining the functional differences between AAC isoforms and identifying the structural basis for these differences.

What insights can chimeric AAC1/AAC2 proteins provide about carrier protein structure and function?

Chimeric protein analysis has provided valuable insights into the structure-function relationships of AAC carriers. By constructing 16 different chimeric combinations of AAC1 and AAC2 sequences, researchers identified specific regions responsible for their functional differences .

Key insights from chimeric studies include:

These insights continue to guide our understanding of how carrier protein structure relates to specific transport functions and how subtle sequence variations can significantly impact cellular physiology.

What are common challenges in working with recombinant AAC1 and how can they be addressed?

Researchers working with recombinant AAC1 may encounter several challenges that require specific methodological solutions:

  • Low expression levels:

    • Challenge: AAC1 is naturally expressed at low levels, which may carry over to recombinant systems

    • Solution: Use strong, inducible promoters and optimize codon usage for the expression system

    • Alternative: Express from the AAC2 locus to achieve physiologically relevant levels

  • Protein instability:

    • Challenge: Membrane proteins like AAC1 may be unstable when extracted from their native environment

    • Solution: Optimize buffer conditions with appropriate detergents and stabilizing agents

    • Alternative: Use fusion partners or stabilizing mutations informed by structural analysis

  • Functional assessment difficulties:

    • Challenge: The reduced functionality of AAC1 makes phenotypic assessment less clear

    • Solution: Use highly sensitive growth assays and quantitative measurements of ATP transport

    • Alternative: Employ chimeric proteins with AAC2 to enhance function while studying specific domains

  • Purification complications:

    • Challenge: Obtaining pure, functional AAC1 in sufficient quantities for biochemical studies

    • Solution: Utilize affinity tags (e.g., 10xHis tag) and optimize purification protocols

    • Alternative: Consider reconstitution systems that require less protein, such as nanodiscs or proteoliposomes

  • Distinguishing from endogenous carriers:

    • Challenge: Separating recombinant AAC1 function from endogenous carriers

    • Solution: Work in genetic backgrounds lacking endogenous AAC proteins (aac1Δ aac2Δ aac3Δ)

    • Alternative: Use epitope tags for specific tracking of recombinant protein

These strategies can significantly improve experimental outcomes when working with this challenging but informative protein.

How can researchers effectively design experiments to study AAC1 function in different genetic backgrounds?

To effectively study AAC1 function across different genetic backgrounds, researchers should implement a systematic experimental design:

  • Strain selection and construction:

    • Start with well-characterized laboratory strains (e.g., S288C background)

    • Generate clean deletion strains (aac1Δ, aac2Δ, aac3Δ, and combinations)

    • Introduce AAC1 at the native AAC2 locus for physiologically relevant expression

    • Consider additional mutations in related pathways (e.g., sal1Δ) to probe specific functions

  • Expression standardization:

    • Use identical promoters and terminators for all constructs

    • Verify expression levels through Western blotting

    • Include epitope tags (e.g., FLAG) for consistent detection

  • Phenotypic assays:

    • Implement quantitative growth measurements (growth curves rather than spot tests)

    • Test multiple carbon sources (fermentable and non-fermentable)

    • Assess growth with and without mitochondrial DNA (rho+ and rho- conditions)

    • Measure resistance to mitochondrial stressors (e.g., oxidative stress, membrane potential disruptors)

  • Control inclusion:

    • Always include wild-type AAC2 as a positive control

    • Include empty vector controls for negative comparison

    • Consider including AAC3 for comparative analysis across all three isoforms

  • Suppressor analysis:

    • Where AAC1 shows functional deficiency, screen for suppressor mutations

    • Sequence and characterize suppressors to identify critical functional residues

This systematic approach ensures rigorous assessment of AAC1 function while controlling for variables that could confound interpretation.

What quality control measures should be implemented when working with recombinant AAC1?

To ensure experimental reliability when working with recombinant AAC1, researchers should implement these essential quality control measures:

  • Sequence verification:

    • Confirm the complete sequence of all constructs before expression

    • Verify the integrity of fusion junctions in chimeric constructs

    • Resequence after any mutagenesis or recombination procedures

  • Expression validation:

    • Confirm protein expression via Western blotting

    • Verify correct size and absence of degradation products

    • Quantify expression levels for comparison between constructs

  • Subcellular localization:

    • Verify proper mitochondrial targeting through fractionation

    • Confirm membrane integration using carbonate extraction

    • If using fluorescent tags, visualize localization by microscopy

  • Functional integrity assessment:

    • Measure ADP/ATP exchange activity in isolated mitochondria

    • Verify rescue of appropriate phenotypes in complementation assays

    • Compare with known functional (AAC2) and non-functional controls

  • Protein quality analysis for biochemical studies:

    • Assess purity through SDS-PAGE (aiming for >85% purity)

    • Verify folding through circular dichroism or thermal stability assays

    • Confirm nucleotide binding capability through direct binding assays

  • Reproducibility measures:

    • Perform biological replicates (minimum of three)

    • Conduct experiments with independently derived constructs

    • Use multiple methodologies to confirm key findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.