Recombinant Saccharomyces cerevisiae ADP,ATP carrier protein 2 (PET9)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae ADP/ATP carrier protein 2 (PET9) is a mitochondrial inner membrane transporter engineered for biochemical and structural studies. It facilitates the exchange of cytosolic ADP with mitochondrial ATP, a critical process for cellular energy homeostasis . PET9, encoded by the PET9/AAC2 gene, is the predominant ADP/ATP carrier in yeast and shares 48% sequence identity with its bovine homolog . Recombinant expression enables large-scale production for functional characterization, structural analysis, and disease modeling .

Key Features of Recombinant PET9:

PropertyDetails
Sequence318 amino acids (UniProt: P18239)
DomainsSix transmembrane α-helices forming a substrate-binding cavity
Quaternary StructureFunctions as a homodimer; tandem-repeated dimers retain transport activity
Post-Translational ModificationsPhosphorylated residues detected in native forms

Structural studies reveal a conserved "crown" architecture with threefold pseudo-symmetry. The substrate-binding cavity contains a tyrosine ladder (Y186, Y190, Y194) and arginine residues (R187) critical for ADP recognition . A sodium ion stabilizes the syn-conformation of bound ADP, while ATP binds less favorably due to steric clashes with its triphosphate tail .

Primary Activities:

  • ADP/ATP Exchange: Transports ADP into mitochondria and exports ATP to the cytosol at a rate of ~500 molecules/sec .

  • Heme Import: Facilitates mitochondrial heme uptake under anaerobic conditions .

Regulatory Interactions:

Interacting ProteinRole in Mitochondrial FunctionInteraction Score
COR1Ubiquinol-cytochrome c reductase complex assembly0.971
COX4Cytochrome c oxidase subunit0.929
POR1Mitochondrial outer membrane voltage-dependent anion channel0.902

PET9 requires Tom70/71 chaperones for mitochondrial import, with ~50% reduced accumulation in Δtom70/71 mutants . Its activity is essential in strains lacking the SAL1 phosphatase .

4.1. Dimerization and Transport Efficiency

Expression of a tandem-repeated PET9 homodimer in yeast mitochondria showed:

  • Membrane Integration: Identical topology to native monomers .

  • Activity Retention: 85–90% of wild-type ADP/ATP exchange rates .

  • Structural Flexibility: Each monomer operates independently, disproving strict cooperative dimer models .

4.2. Substrate Specificity Mechanism

Molecular dynamics simulations identified two binding sites:

  1. Central Site: Binds ADP/ATP during conformational transitions.

  2. Selectivity Filter (Site S2):

    • Recognizes ADP via hydrogen bonds with R187 and N115 .

    • Excludes ATP due to unfavorable interactions with its γ-phosphate (ΔG = +6 kcal/mol vs. ADP) .

4.3. Isoform Functional Divergence

AAC2 (PET9) outperforms AAC1/AAC3 in:

  • ATP Import Capacity: Critical for viability in ρ⁰ (mitochondrial DNA-deficient) strains .

  • Respiration Efficiency: Supports 3× faster growth on glycerol vs. AAC1 .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
PET9; AAC2; YBL030C; YBL0421; ADP,ATP carrier protein 2; ADP/ATP translocase 2; Adenine nucleotide translocator 2; ANT 2; Petite colonies protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PET9
Target Protein Sequence
MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQ GTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKT LKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG VISMYDQLQMILFGKKFK
Uniprot No.

Target Background

Function
ADP:ATP antiporter, responsible for mediating the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. This carrier transitions between the cytoplasmic-open state (c-state) and the matrix-open state (m-state). It functions via the alternating access mechanism, employing a single substrate-binding site that is alternately exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Gene References Into Functions
  1. Yeast aac2 R96H and aac2 R252G mutations are equivalent to R80H and R235G human ANT1 pathological mutations. The mtDNA instability induced by aac2R96H and aac2R252G can be rescued by N-acetylcysteine. PMID: 28947214
  2. Mutations in yeast Aac2, analogous to those found in human Ant1 associated with progressive external ophthalmoplegia, lead to protein misfolding. Misfolded Aac2 affects the assembly and stability of multiple protein complexes within the membrane, ultimately inhibiting cell growth. PMID: 25833713
  3. The protective role of cathepsin D in acetic acid-induced apoptosis is dependent on ANT (Aac2p) but not on the voltage-dependent channel (Por1p). PMID: 23220089
  4. Yeast ADP/ATP carrier isoform 2: conformational dynamics and role of the RRRMMM signature sequence methionines PMID: 21868387
  5. Aac2p and Sal1p may define two distinct parallel pathways that transport a nucleotide substrate in a mode that differs from ADP/ATP exchange. PMID: 15238515
  6. The dynamic structural change observed in the twisting of the second transmembrane alpha-helix of yeast mitochondrial ADP/ATP carrier (AAC) between matrix-state and cytosol-state provides insights into the process of AAC substrate translocation. PMID: 15568812
  7. The structural and functional features of the cytosolic-facing first loop (LC1) including its surrounding region PMID: 15628859
  8. The functional form of Ancp is a dimer. PMID: 16274221
  9. Results indicate that the matrix loop m2 of the mitochondrial ADP/ATP carrier intrudes to some extent into the inner mitochondrial membrane and may be involved in the translocation of ADP/ATP. PMID: 16331992
  10. The C-terminal region of the second cytosolic loop in AAC2 changes its environment when the carrier cycles between the matrix and cytosolic state. PMID: 16962388
  11. The residual transport activity in the presence of MTSES depended linearly on the amount of cysteine-less carrier. Therefore, the entire transport cycle for ADP/ATP exchange is carried out by the monomer. PMID: 17566106
  12. Yeast ADP/ATP carriers are monomeric in detergents, consistent with their hydrodynamic properties. PMID: 17572439
  13. The Anc2p C-terminal region plays a role in nucleotide recognition, binding, and transport. PMID: 18299327
  14. The yeast Sal1 and Aac2 carriers exhibit pleiotropic effects on mitochondrial function via an activity distinct from adenine nucleotide transport. PMID: 18431598
  15. Aac2 exists in physical association with the cytochrome bc1-COX supercomplex and the TIM23 machinery. PMID: 18614795
  16. Pathogenic mutations likely enhance the intrinsic proton-conducting activity of adenine nucleotide translocase Aac2, excessively uncoupling the mitochondrial inner membrane, which in turn affects energy transduction and mitochondrial biogenesis. PMID: 18809618
  17. Tyr203 and Phe208, aromatic residues in the Anc2 transmembrane domain 4 protein carrier, may contribute to nucleotide attraction and its movement through the carrier, leading to a productive adenosine diphosphate/adenosine triphosphate exchange. PMID: 19086155

Show More

Hide All

Database Links

KEGG: sce:YBL030C

STRING: 4932.YBL030C

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is PET9 and what is its primary function in Saccharomyces cerevisiae?

PET9 (also known as AAC2) is the major ADP/ATP carrier protein located in the mitochondrial inner membrane of Saccharomyces cerevisiae. Its primary function is to exchange cytosolic ADP for mitochondrially synthesized ATP, thereby serving as a critical link between energy production in mitochondria and energy utilization in the cytosol. PET9 also imports heme and ATP and is required for viability in many laboratory strains that carry a sal1 mutation . The protein consists of 309 amino acids and exhibits high homology with mitochondrial translocator proteins from other species . PET9 belongs to the nuclear-encoded respiratory-defective mutants (pet mutants) collection, which represents a substantial fraction of the genetic information required for maintaining functional mitochondria in S. cerevisiae .

How is PET9 structurally and functionally different from other mitochondrial proteins?

Unlike many other mitochondrial precursor proteins, PET9 does not contain a transient N-terminal presequence that typically directs posttranslational localization to mitochondria . Instead, import information for PET9 is contained within the first 115 amino acid residues of the protein itself. Gene fusion studies have revealed that the N-terminal region of PET9 serves a dual function: it provides targeting to mitochondria and prevents membrane-anchoring sequences (located between residues 78 and 98) from prematurely stopping import at the outer mitochondrial membrane . This distinctive import mechanism makes PET9 an interesting model for studying alternative mitochondrial import pathways.

What experimental systems have been developed to study PET9 expression and function?

Several experimental systems have been developed to study PET9:

  • Gene fusion approaches: PET9-lacZ gene fusions have been constructed to define sequences necessary for mitochondrial delivery of the PET9 protein in vivo .

  • Recombinant expression systems: PET9 has been expressed in various systems including E. coli, yeast, baculovirus, and mammalian cells for biochemical and structural studies .

  • Chimeric protein systems: A fusion protein combining the yeast mitochondrial ADP/ATP carrier (Anc2p/PET9) with iso-1-cytochrome c (Cyc1p) has been developed to increase the polar surface of the carrier and improve its crystallization properties .

  • Genetic expression vs. plasmid overexpression: Both methods have been used to study PET9, with research showing that plasmid overexpression doesn't necessarily increase expression levels compared to homologous recombination methods .

What protein interaction networks involve PET9 in mitochondrial function?

PET9 participates in several key protein-protein interactions within mitochondria:

Interaction PartnerInteraction ScoreFunction
COR10.971Core subunit of ubiquinol-cytochrome c reductase complex
COX40.929Subunit IV of cytochrome c oxidase
QCR20.921Subunit 2 of ubiquinol cytochrome-c reductase
POR10.902Mitochondrial porin (voltage-dependent anion channel)
MIR10.893Mitochondrial phosphate carrier

These interactions highlight PET9's central role in respiratory chain function and mitochondrial metabolism . Additionally, PET9 has been shown to interact with AAC1, another ADP/ATP carrier, with implications for mitochondrial outer membrane permeabilization and cytochrome c release in yeast apoptosis .

What are the optimal conditions for expressing and purifying functional recombinant PET9 protein?

Expression and purification of functional recombinant PET9 requires careful optimization:

Expression system selection:

  • E. coli systems are suitable for basic structural studies but may lack post-translational modifications

  • Yeast expression (homologous) provides the most native-like protein with proper folding and modification

  • Baculovirus or mammalian expression systems may be preferred for complex functional studies

Purification protocol:

  • Extraction with appropriate detergents: n-dodecyl-β-D-maltoside (DoDM) has been identified as the optimal detergent for solubilizing PET9

  • Affinity purification: His6-tagged versions facilitate one-step purification

  • Quality control: Functional assessment through nucleotide binding assays

  • Storage: Glycerol-containing buffers at -20°C or -80°C for extended storage

Critical attention must be paid to preserving the native conformation during purification, as research has shown that carboxyatractyloside (CATR) and nucleotide-binding sites must be preserved in the purified protein to maintain functionality .

How can gene fusion approaches be effectively utilized to study PET9 localization and function?

Gene fusion approaches provide powerful tools for studying PET9:

Methodology for creating informative PET9 fusion constructs:

  • Selection of fusion partner: β-galactosidase (lacZ) has been successfully used to track localization , while iso-1-cytochrome c (Cyc1p) improves crystallization properties

  • Junction point determination: Critical for preserving function; the first 115 amino acids of PET9 contain sufficient information for mitochondrial targeting

  • Expression control: Using either native PET9 regulatory sequences or strong promoters like PMA1

  • Functional validation: Testing for complementation of pet9 mutant phenotypes on non-fermentable carbon sources to confirm activity

The Anc2-Cyc1(His6)p fusion protein has demonstrated particular utility as it retains transport activity while providing improved crystallization properties. This chimeric carrier can restore growth on non-fermentable carbon sources in yeast strains lacking functional ADP/ATP carrier, confirming its transport capability . Additionally, the Cyc1p moiety remains able to interact with cytochrome c oxidase with the same affinity as native Cyc1p, making this fusion particularly valuable for studying respiratory chain complex interactions .

What structural elements of PET9 are critical for substrate specificity and transport mechanism?

Molecular dynamics simulations and structural studies reveal key elements determining PET9's substrate specificity:

Critical structural features:

  • Second basic patch: Residues K91, K95, and R187 are crucial for ADP recognition

  • Tyrosine ladder: Y186, Y190, and Y194 contribute to substrate specificity

  • Key residues: F191 and N115 in the upper cavity region are involved in discriminating between ADP and ATP

  • Dual binding sites: Evidence suggests PET9 uses different sites for substrate recognition and conformational transition:

    • The upper region of the cavity for substrate discrimination

    • The central binding site for transport-associated conformational changes

This differentiated binding strategy allows PET9 to maintain high substrate specificity even during the dynamic transport process. Mutations in these key residues reduce ADP transport across membranes and induce defects in oxidative phosphorylation and ATP production in yeast .

How do pathogenic mutations in PET9 contribute to mitochondrial dysfunction and disease mechanisms?

Pathogenic mutations in PET9 (and its human homolog ANT1) reveal a novel disease mechanism:

Protein import clogging mechanism:

  • Mutation consequences: Pathogenic missense mutations cause the protein to accumulate along the import pathway, obstructing general protein translocation into mitochondria

  • Impact pathway: This blockage impairs mitochondrial respiration, cytosolic proteostasis, and cell viability independent of PET9's nucleotide transport activity

  • Synergistic effects: Double mutations (e.g., Aac2 A128P,A137D) cause severe clogging primarily at the translocase of the outer membrane (TOM) complex

  • Disease relevance: In mouse models, expression of "super-clogger" ANT1 variants leads to neurodegeneration and age-dependent dominant myopathy that phenocopy ANT1-induced human disease

Import assays using 35S-labeled Aac2p variants have demonstrated that while single mutations show minimal import defects, double mutations reduce IMM integration by >70% and increase association with the TOM complex . The transcriptional response to these mutations includes upregulation of CIS1 (hallmark of mitochondrial compromised protein import response) and stress response genes RPN4, HSP82, SSA3, and SSA4 .

What experimental approaches are most effective for studying PET9's ADP/ATP exchange activity?

Several complementary approaches provide insights into PET9's transport function:

Functional assay methodologies:

  • In vivo complementation tests: Assessing growth restoration of pet9 mutants on non-fermentable carbon sources

  • Reconstitution in liposomes: Purified PET9 can be reconstituted into liposomes for direct transport measurements

  • Inhibitor binding studies: Using specific inhibitors like carboxyatractyloside (CATR) to assess binding site integrity

  • Blue native PAGE analysis: For analyzing the assembly state of the carrier

  • Mitochondrial import assays: Using 35S-labeled precursors to monitor transport kinetics and efficiency

When designing these experiments, it's important to note that while single-site mutations might not show dramatic effects in vitro, they can have significant consequences in vivo, particularly under stress conditions or when combined with other mutations .

What strategies can enhance the production and crystallization of recombinant PET9 for structural studies?

Improving PET9 crystallization remains challenging but several strategies have proven effective:

Production enhancement approaches:

  • Synthetic propeptide design: Adding secretion-enhancing peptide cassettes can increase production by up to 190%

  • Optimization parameters:

    • N-glycosylation sites

    • Net negative charge balance

    • Glycine-rich flexible linkers

Crystallization improvement strategies:

  • Fusion protein approach: The Anc2-Cyc1(His6)p fusion increases polar surface area, improving crystallization properties

  • Detergent selection: n-dodecyl-β-D-maltoside (DoDM) optimally preserves functional state

  • Stable complex formation: Purifying PET9 in complex with its inhibitor carboxyatractyloside (CATR) increases stability

  • Surface engineering: Modifying surface-exposed residues can reduce conformational flexibility

These strategies have opened new possibilities for crystallographic approaches to the yeast ADP/ATP carrier, potentially providing structural insights that complement functional studies and molecular dynamics simulations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.