Recombinant Saccharomyces cerevisiae ADP,ATP carrier protein 3 (AAC3)

Shipped with Ice Packs
In Stock

Description

Regulatory Mechanisms

AAC3 expression is tightly regulated by oxygen and carbon source availability:

Regulatory FactorMechanismEffect
Oxygen (ROX1)Binds upstream repressing sequence 2 (URS2) under aerobic conditionsRepresses AAC3 expression
Carbon Source (RAP1, Ethanol)Binds upstream repressing sequence 1 (URS1) when glucose is abundantRepresses AAC3 via RAP1 and ethanol-responsive elements
Anaerobic ConditionsRelief of repression via ROX1 and carbon-source signalsActivates AAC3 transcription for glycolytic ATP import

Deletion of URS1 or URS2 leads to constitutive or partial derepression, respectively, highlighting the combinatorial control of AAC3 .

Role in Cellular Metabolism

AAC3 is indispensable for mitochondrial ATP import during anaerobic growth:

  • Glycolytic ATP Transport: Facilitates the influx of ATP produced via glycolysis into mitochondria, bypassing oxidative phosphorylation .

  • Viability Maintenance: Critical for maintaining mitochondrial membrane potential and respiratory function under hypoxic conditions .

  • Differential Expression: Aac3p is expressed almost exclusively under anaerobiosis, contrasting with Aac2p (aerobic) and Aac1p (low-level expression) .

Recombinant Production and Applications

While direct data on recombinant AAC3 production is limited, insights from related systems suggest:

  • Heterologous Expression: AAC3 could be expressed in E. coli or P. pastoris under anaerobic conditions, leveraging inducible promoters (e.g., AOX1) .

  • Challenges: Mitochondrial targeting sequences and proper folding in non-native hosts may require optimization .

  • Potential Uses:

    • Biotechnology: Enhancing ATP transport in recombinant yeast for biofuel or metabolite production.

    • Structural Studies: Solving high-resolution structures of AAC3 to elucidate transport mechanisms .

Comparative Analysis with Other Isoforms

FeatureAAC3AAC2AAC1
ExpressionAnaerobicAerobicLow-level
Substrate K<sub>M</sub>~8.4 µM (ADP)~2.5–3.7 µM (ADP)N/A
Biological RoleGlycolytic ATP importOxidative ATP exportRedundant/backup
RegulationROX1, carbon-source responsiveUnregulatedUncharacterized

Data synthesized from .

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format currently in stock, we are happy to accommodate any special requirements you may have. Please specify your preferred format when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
AAC3; YBR085W; YBR0753; ADP,ATP carrier protein 3; ADP/ATP translocase 3; Adenine nucleotide translocator 3; ANT 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
AAC3
Target Protein Sequence
MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNL ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTV RRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMI LFGKKFK
Uniprot No.

Target Background

Function
ADP:ATP antiporter plays a crucial role in mediating the import of ADP into the mitochondrial matrix, facilitating ATP synthesis. It also exports ATP to power cellular functions. This antiporter operates through an alternating access mechanism, cycling between the cytoplasmic-open state (c-state) and the matrix-open state (m-state). A single substrate-binding site is intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Gene References Into Functions
  1. Data indicate that ADP/ATP carrier protein AAC3 predominantly resides in the cytosol-facing open state. It transitions to a sparsely populated state in an asymmetric manner, despite its three-fold structural symmetry. PMID: 26167881
  2. Research suggests that the apparent mass of AAC3 fluctuates in a detergent- and lipid-dependent manner during gel electrophoresis. PMID: 23744064
Database Links

KEGG: sce:YBR085W

STRING: 4932.YBR085W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural arrangement of Saccharomyces cerevisiae ADP/ATP carrier protein 3 (AAC3)?

AAC3 forms a barrel-like structure with six transmembrane α-helices surrounding a central translocation pathway, arranged with threefold pseudosymmetry. X-ray crystallography studies have revealed that the odd-numbered transmembrane helices are kinked at proline or serine residues. The carrier has three domains, each consisting of an odd-numbered transmembrane helix, a loop including a short matrix helix, and an even-numbered transmembrane helix . Compared to mammalian orthologs, yeast AAC3 has an extended N-terminal region, with H1 protruding about 8 Å from the cytoplasmic surface of the protein .

The highly conserved Px[DE]xx[KR] signature motif forms salt bridges on the matrix side, closing the central cavity to the mitochondrial matrix. The central cavity is open to the cytoplasmic side of the membrane, but closed to the matrix, creating an asymmetric transport channel .

How does the expression pattern of AAC3 differ from other ADP/ATP carriers in S. cerevisiae?

S. cerevisiae contains three isoforms of the ADP/ATP carrier (AAC1, AAC2, and AAC3) that are differentially expressed under different physiological conditions:

CarrierExpression PatternPrimary Function
AAC1Low level expressionSecondary role in ADP/ATP exchange
AAC2Principal carrier in aerobic growthPrimary ADP/ATP exchange during aerobic respiration
AAC3Expressed almost exclusively under anaerobic conditionsTransport of glycolytic ATP into mitochondrion

AAC3 is specifically regulated by two upstream repressor sites: one controlled by oxygen and haem (URS2, which binds the ROX1 repressor), and another by carbon source (URS1, which includes a RAP1-binding site and two putative ethanol-repression sequences) . These regulatory elements function to completely switch off AAC3 expression when ATP is made by oxidative phosphorylation and modulate its expression when import of glycolytic ATP into mitochondria is required .

What molecular mechanisms control the transcriptional regulation of the AAC3 gene?

The AAC3 gene is subject to complex transcriptional regulation involving multiple cis-acting elements and trans-acting factors. Deletion analysis, DNA electrophoretic mobility-shift assays, DNase I footprinting, and site-directed mutagenesis have identified two key upstream repression sequences (URS) :

  • URS1 (carbon-source-dependent repression) - Contains:

    • A RAP1 (repressor activator protein 1) binding site

    • Two putative ethanol-repression sequences

  • URS2 (oxygen-dependent repression) - Contains:

    • ROX1 (regulation by oxygen 1) repressor-binding region

The complex interplay between these regulatory elements ensures that AAC3 expression is repressed when yeast cells are growing aerobically and ATP is produced by oxidative phosphorylation. Modification of the ethanol-repression sequences in the URS1 region has been shown to derepress AAC3 gene expression . This sophisticated regulatory mechanism allows S. cerevisiae to adapt its energy metabolism to changing environmental conditions.

What is the current understanding of AAC3's transport mechanism?

Structural and functional studies support an alternating-access transport mechanism involving domain-based motions. In this model:

  • Salt-bridge networks act as gates, providing controlled access to a central substrate-binding site

  • The carrier alternates between two conformational states:

    • Open to the cytoplasmic side and closed to the mitochondrial matrix (as observed in crystal structures)

    • Open to the matrix and closed to the cytoplasm

The highly conserved Px[DE]xx[KR] signature motif plays a crucial role in this mechanism, with the charged residues forming salt bridges on the matrix side that close the central cavity . This conformational switching facilitates the exchange of ADP and ATP across the mitochondrial inner membrane.

The presence of cardiolipin, a phospholipid found in the inner mitochondrial membrane, appears to be important for maintaining the proper structure and function of AAC3, suggesting that lipid-protein interactions contribute to the transport mechanism .

How do specific inhibitors interact with AAC3 and what research insights do they provide?

Specific inhibitors like carboxyatractyloside (CATR) and atractyloside (ATR) have been instrumental in elucidating AAC3's structure and mechanism:

InhibitorBinding AffinityEffect on Carrier Structure
CATRKd ~15 μM by ITCLocks carrier in conformation open to cytoplasm
ATRLower affinity than CATRSimilar locking effect as CATR

These inhibitors differ by one carboxylate group and lock the carrier in a specific conformation open to the cytoplasmic side and closed to the matrix . This stabilization of a particular conformational state has facilitated structural studies by reducing conformational heterogeneity.

Inhibition assays with CATR serve as valuable tools for assessing whether recombinant AAC3 maintains native-like binding properties. For example, a functional assay demonstrated that purified AAC3 from yeast mitochondria showed specific inhibition of ADP transport at defined CATR concentrations . This provides a benchmark for comparing recombinant variants and assessing their functional integrity.

Which expression systems are most suitable for producing functional recombinant AAC3?

Several expression systems have been employed for AAC3 production, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsKey Considerations
E. coliHigh yield, simple genetic manipulationChallenges with proper foldingRequires optimization of induction conditions
S. cerevisiaeNative environment, proper foldingLower yield than bacterial systemsWB-12 strain (Δaac1 Δaac2) enables functional complementation
Other yeastsCan provide higher yields than S. cerevisiaeMay require codon optimizationNeed to develop appropriate selection markers

Expression in S. cerevisiae strains lacking endogenous ADP/ATP carriers (such as strain WB-12 with disrupted AAC1 and AAC2 genes) has proven particularly valuable for functional studies . For such expression, vectors containing strong constitutive promoters (such as the promoter region upstream of the yeast AAC2 gene) have demonstrated efficacy .

The inclusion of appropriate secretion signals and purification tags (typically an N-terminal His-tag with a cleavage site) facilitates downstream purification and characterization . Additionally, codon optimization strategies can significantly impact expression levels, though results can vary substantially among gene variants .

How can codon optimization enhance expression of recombinant AAC3?

Codon optimization can significantly impact the expression levels of recombinant AAC3, though outcomes vary considerably depending on the specific optimization strategy and host system:

Research with fungal genes in S. cerevisiae demonstrates that codon optimization does not universally guarantee improved protein production. Studies with different enzymes have shown that codon-optimized variants displayed variable improvements in expression levels, ranging from 1.6-fold to 3.3-fold increases in extracellular activity compared to native sequences .

When designing codon-optimized AAC3 constructs, researchers should consider:

  • Codon adaptation index for the target organism

  • mRNA secondary structure prediction

  • GC content optimization

  • Elimination of rare codon clusters

Beyond codon optimization, expression can be further enhanced by selecting appropriate terminal sequences. Research with reporter genes has shown that terminator choice can impact expression levels, with some terminators (such as ALY2 T) increasing activity by up to 14% compared to commonly used terminators like ENO1 T .

A systematic approach testing multiple codon-optimized variants and promoter-terminator combinations is recommended to identify the optimal expression construct for AAC3 in any given host system.

What are the critical factors for maintaining AAC3 structural integrity during purification?

Maintaining the structural and functional integrity of recombinant AAC3 during purification presents significant challenges that require careful optimization:

  • Detergent selection is crucial:

    • Dodecyl-maltoside (DDM) preserves functional state

    • 5-cyclohexyl-1-pentyl-β-d-maltoside and n-decyl-β-d-maltoside have been used successfully for crystallization

    • Dodecyl-phosphocholine (DPC/Foscholine-12) causes immediate loss of tertiary structure and inactivation

  • Purification workflow optimization:

    • Membrane solubilization with appropriate detergents

    • Affinity chromatography (typically Ni-Sepharose for His-tagged constructs)

    • Factor Xa cleavage for tag removal if necessary

  • Storage recommendations:

    • Include stabilizers like glycerol (5-50% final concentration)

    • Store at -20°C or -80°C in aliquots to avoid repeated freeze-thaw cycles

    • Consider inclusion of cardiolipin, which contributes to carrier stability

Monitoring protein integrity throughout purification is essential, typically through functional assays or binding studies with specific inhibitors like carboxyatractyloside (CATR).

What techniques can verify the proper folding and functionality of purified recombinant AAC3?

Verifying that recombinant AAC3 maintains native-like structure and function requires a multi-faceted approach:

  • Transport assays:

    • Reconstitution into liposomes

    • Measurement of 14C-ADP uptake

    • Inhibition studies with CATR and ATR

  • Complementation studies:

    • Expression in S. cerevisiae WB-12 strain (Δaac1 Δaac2)

    • Assessment of growth restoration on non-fermentable carbon sources

  • Binding studies:

    • Isothermal titration calorimetry (ITC) with CATR (expected Kd ~15 μM)

    • NMR-based chemical shift perturbation analyses

  • Structural analysis:

    • Circular dichroism spectroscopy for secondary structure assessment

    • Limited proteolysis to assess compact folding

    • Thermal stability assays

Disparities between different analytical techniques may indicate structural or functional defects. For example, researchers have observed a 10-fold difference in CATR binding affinity measured by ITC (~15 μM) versus NMR (~150 μM), suggesting potential issues with protein stability in the NMR experiments .

What crystallization strategies have proven successful for obtaining high-resolution structures of AAC3?

Successful crystallization of AAC3 for high-resolution structural studies has required careful optimization of multiple parameters:

  • Detergent selection:

    • 5-cyclohexyl-1-pentyl-β-d-maltoside for AAC2

    • n-decyl-β-d-maltoside for AAC3

  • Crystallization techniques:

    • Vapor diffusion methods after concentration of purified protein

    • Multiple crystal forms obtained (P21 and other space groups)

  • Structural insights from different crystal forms:

    • P21 crystal form reveals extended N-terminal region

    • P212121 crystal reveals C-terminal folding back into the cavity

  • Data collection parameters:

    • Synchrotron radiation facilities (European Synchrotron Radiation Facility beamline ID23-2)

    • Molecular replacement using bovine ADP/ATP carrier structure (PDB ID 1OKC)

Different crystal packing arrangements have revealed important structural features, highlighting the value of exploring multiple crystallization conditions. The use of specific inhibitors like CATR has been crucial for stabilizing the protein in a defined conformational state suitable for crystallization .

What CRISPR-based strategies can effectively modify the AAC3 gene in S. cerevisiae?

CRISPR-Cas9 has revolutionized genetic engineering of S. cerevisiae, including modification of genes like AAC3:

RNA-guided Cas9 nuclease has emerged as a particularly effective tool, with studies demonstrating its ability to achieve gene disruptions in polyploid yeast strains with success rates of up to 60% in positive colonies after targeted gene disruption . This represents a substantial improvement over older methods like TALENs, which showed much lower efficiency (around 10%) even in haploid strains .

When designing a CRISPR-Cas system for AAC3 modification:

  • Use a multicopy plasmid with the gRNA cassette under control of a constitutive yeast promoter

  • Target unique sequences within the AAC3 gene to avoid off-target effects

  • Design repair templates with appropriate homology arms for precise gene editing

A key benefit of this approach is that after target gene modification, both the Cas9 and gRNA plasmids can be easily removed from the host strain by a 24-hour culture under non-selective conditions (e.g., YPD medium), which is favorable when considering GMO regulations for engineered yeast strains .

For creating auxotrophic marker strains using AAC3, integration of selection markers (like URA3, TRP1, LEU2, or HIS3) can be achieved through precise CRISPR-mediated gene disruption, with knockouts observed in up to 60% of positive colonies .

How can researchers develop S. cerevisiae strains with modified AAC3 for metabolic engineering applications?

Developing S. cerevisiae strains with modified AAC3 for specific metabolic engineering applications requires strategic approaches:

  • Adaptive evolution strategies:

    • Serial transfer and dilution in selective media

    • Selection for specific growth characteristics

    • Can improve strain performance even after genetic engineering

  • Promoter engineering:

    • Modification of regulatory elements controlling AAC3 expression

    • Can tune expression levels for specific metabolic contexts

    • Deletion analysis to identify minimal functional promoter regions

  • Integration of AAC3 modifications with other metabolic pathways:

    • Coordinate AAC3 expression with glycolytic/fermentative pathways

    • Consider interaction with other transporters and metabolic enzymes

    • May require balancing expression of multiple genes

  • Strain development considerations:

    • Use of quadruple auxotrophic mutants (ura3, trp1, leu2, his3) as background strains

    • Retention of beneficial industrial traits (temperature tolerance, inhibitor resistance)

    • Careful phenotypic characterization to confirm desired properties

Recombinant S. cerevisiae strains have been successfully engineered for various industrial applications, including lactic acid production (~20 g/liter with productivities of 11 g/liter/h) and xylitol production (95% conversion from xylose) , demonstrating the potential for metabolic engineering approaches incorporating AAC3 modifications.

How does AAC3 compare structurally and functionally to other mitochondrial carriers?

Comparative analysis reveals both conserved features and specializations of AAC3:

FeatureAAC3AAC1/AAC2Mammalian ADP/ATP Carriers
Basic fold6 transmembrane helices6 transmembrane helices6 transmembrane helices
N-terminal regionExtendedExtendedShorter
Signature motifPx[DE]xx[KR]Px[DE]xx[KR]Px[DE]xx[KR]
Expression patternAnaerobic-specificAerobic (AAC2), low levels (AAC1)Not oxygen-regulated
Inhibitor sensitivityCATR, ATR sensitiveCATR, ATR sensitiveCATR, ATR sensitive

Functionally, while all facilitate nucleotide exchange across the mitochondrial inner membrane, AAC3's specific expression under anaerobic conditions represents a specialized adaptation in yeast metabolism . This contrasts with organisms that lack this oxygen-regulated isoform diversity.

The structural similarity despite functional specialization underscores how relatively minor sequence variations can tune the properties of these carriers for specific metabolic contexts.

How can AAC3 be utilized as a model system for studying mitochondrial carrier proteins?

AAC3 offers several advantages as a model system for studying mitochondrial carrier proteins:

  • Expression regulation:

    • Well-characterized oxygen and carbon source responsive elements

    • Enables study of transcriptional control mechanisms

  • Structural features:

    • Multiple high-resolution crystal structures available

    • Reveals conformational states and molecular details of transport mechanism

  • Functional assays:

    • Well-established reconstitution and transport assays

    • Clear inhibition profiles with CATR and ATR

  • Genetic tractability:

    • Amenable to CRISPR-Cas9 modification

    • Can be studied in well-characterized S. cerevisiae genetic backgrounds

  • Comparative approaches:

    • Can be studied alongside AAC1 and AAC2 to understand isoform-specific functions

    • Comparison with mammalian carriers reveals evolutionary adaptations

The availability of both structural and functional data makes AAC3 particularly valuable for studying structure-function relationships in mitochondrial carriers. Its distinct regulation under anaerobic conditions also provides insights into how these carriers adapt to different metabolic states.

What insights does AAC3 provide about mitochondrial bioenergetics in varying oxygen conditions?

AAC3's specialized role provides unique insights into mitochondrial adaptation to anaerobic conditions:

The differential expression of AAC isoforms (AAC1, AAC2, and AAC3) under varying oxygen conditions reveals the adaptability of mitochondrial function. While AAC2 is the principal carrier during aerobic growth, AAC3 is expressed almost exclusively under anaerobic conditions, where it is thought to transport ATP produced by glycolysis into the mitochondrion .

This specialized role highlights that mitochondria remain important organelles even under anaerobic conditions, requiring ATP import to maintain essential functions like protein import and maintenance of membrane potential. The regulation of AAC3 by both oxygen-responsive elements and carbon source-responsive elements enables fine-tuned expression based on cellular metabolic state .

The discovery that AAC3 transports glycolytic ATP into mitochondria under anaerobic conditions challenges the traditional view of mitochondria as purely respiratory organelles. This insight has broader implications for understanding eukaryotic adaptation to changing oxygen availability and the evolutionary origins of mitochondrial function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.