Recombinant Saccharomyces cerevisiae Alkaline ceramidase YDC1 (YDC1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Alkaline Ceramidase YDC1 (YDC1)

Recombinant YDC1 is a bioengineered form of the Saccharomyces cerevisiae alkaline ceramidase YDC1, expressed in E. coli for functional and structural studies. This enzyme belongs to the CREST superfamily and catalyzes the hydrolysis of ceramides, particularly dihydroceramides, with minimal activity toward phytoceramides or mammalian-type ceramides .

Amino Acid Sequence and Expression

Recombinant YDC1 (UniProt ID: Q02896) spans 317 amino acids (aa) with an N-terminal His-tag for purification . The full-length sequence includes conserved motifs critical for catalysis, such as histidine and aspartate residues .

PropertyDetails
Gene NameYDC1 (synonyms: YPL087W, LPG21W)
Source OrganismSaccharomyces cerevisiae
Expression SystemE. coli
TagN-terminal 10xHis-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Catalytic Activity and Substrate Specificity

YDC1 exhibits:

  • Primary Substrate: Dihydroceramides (C14–C26 fatty acids) .

  • Secondary Activity: Minor hydrolysis of phytoceramides .

  • No Activity: Toward unsaturated mammalian ceramides .

  • Optimal pH: Alkaline conditions (~pH 8) .

Reverse Activity: In vitro, YDC1 can synthesize dihydroceramides from fatty acids and dihydrosphingosine, but this is not observed in vivo .

Functional Redundancy and Stress Responses

  • Genetic Redundancy: Single deletions (Δydc1 or Δypc1) show minimal phenotypes, but Δydc1Δypc1 double mutants lack ceramidase activity .

  • Heat Stress Sensitivity: Δydc1 mutants exhibit increased sensitivity to heat stress, implicating dihydroceramides in stress adaptation .

  • Sphingolipid Metabolism: YDC1 regulates ceramide turnover but does not alter sphingolipid profiles under normal conditions .

Experimental Uses

Recombinant YDC1 is employed in:

  • Enzymatic Assays: Microsomal preparations to study ceramide hydrolysis .

  • SDS-PAGE: For protein purity validation .

  • Structural Studies: To elucidate catalytic mechanisms in the CREST superfamily .

ApplicationMethod
Ceramide HydrolysisMicrosomal assays with HPLC detection .
Protein PurificationNi-NTA affinity chromatography (via His-tag) .
Stress Response StudiesGenetic screens with Δydc1 mutants .

Catalytic Mechanism

YDC1 belongs to Zn²⁺-dependent amidases, though direct evidence for Zn²⁺ involvement in yeast ceramidases remains limited . Mutational studies in human ACER3 (a homolog) suggest conserved residues (H81, H217, H221, D92) critical for activity , but analogous data for YDC1 are sparse.

Genetic Interactions

  • No Synthetic Lethality: Chemical-genetic screens on Δydc1Δypc1 mutants revealed no critical growth dependencies .

  • Chronological Lifespan: YPC1 (but not YDC1) reduces lifespan under caloric restriction .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes section. We will fulfill your specific needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
YDC1; YPL087W; LPG21W; Alkaline ceramidase YDC1; Acyl-CoA-independent ceramide synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDC1
Target Protein Sequence
MLFSWPYPEAPIEGYWGKPTSLIDWCEENYVVSPYIAEWSNTITNSIFLMTAFYSTYSAW RNKLETRYILIGMGFSLVGIGSWLFHMTLQYRYQLLDELPMLYATIIPSWSIFAETQEIL IKDEKKRKESSFRIQMVISFIMCGIVTILTWIYVVVQKPAIFQVLYGILTLLVVVLSGWL TYYHVHDSFAKKNLFITMVMGMIPFVIGFICWQLDIHLCSFWIYIRRTYLALPLGVLLEL HAWWHLLTGTGVYIFVVYLQYLRILTHGNPNDFLFIWRWGFFPELVRKGLPIGTSYSLEY LGPIVNTQVDDETKKNN
Uniprot No.

Target Background

Function
Acyl-CoA-independent ceramide synthase that catalyzes the conversion of dihydroceramide and phytoceramide into dihydrosphingosine or phytosphingosine. Exhibits a preference for dihydroceramide. Possesses very low reverse hydrolysis activity, catalyzing the synthesis of dihydroceramide from fatty acid and dihydrosphingosine. It does not contribute to the breakdown of unsaturated ceramide. May play a role in the heat stress response.
Gene References Into Functions
  1. Overexpression of YDC1 results in reduced chronological lifespan and increased apoptotic cell death. PMID: 18500447
Database Links

KEGG: sce:YPL087W

STRING: 4932.YPL087W

Protein Families
Alkaline ceramidase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is YDC1 and how does it differ from YPC1?

YDC1 is an alkaline ceramidase encoded by the YDC1 gene in Saccharomyces cerevisiae. It functions as a homologue of the YPC1 gene, with both encoding alkaline ceramidases located in the early secretory pathway. The primary distinction between these enzymes lies in their substrate specificity. YDC1p (the protein product of YDC1) preferentially hydrolyzes dihydroceramide, whereas YPC1p preferentially hydrolyzes phytoceramide. This substrate differentiation suggests distinct physiological roles for each enzyme despite their structural similarities . Neither enzyme demonstrates hydrolytic activity against unsaturated mammalian-type ceramides, highlighting their specificity for yeast sphingolipids . The two enzymes also differ in their reverse activity (ceramide synthesis), with YDC1p exhibiting only minor in vitro reverse activity of catalyzing dihydroceramide formation from free fatty acid and dihydrosphingosine .

What are the biochemical properties of YDC1?

YDC1 functions optimally in alkaline conditions (hence its classification as an alkaline ceramidase). The enzyme catalyzes the hydrolysis of the N-acyl linkage in dihydroceramide, releasing free fatty acid and dihydrosphingosine. Unlike many mammalian ceramidases, YDC1 demonstrates highly specific substrate preferences, showing significant activity toward dihydroceramide but only slight activity toward phytoceramide . This specificity is critical for researchers designing experiments to measure YDC1 activity. When conducting in vitro assays with YDC1, it's essential to use dihydroceramide substrates rather than phytoceramide or unsaturated ceramides to obtain accurate measurements of enzymatic activity .

How can I create and verify YDC1 deletion strains?

To create YDC1 deletion strains, researchers typically use homologous recombination techniques with a selectable marker cassette. The procedure involves:

  • Design primers with 40-50bp homology to sequences flanking the YDC1 gene and 20bp homology to a selectable marker (e.g., KanMX4 for G418 resistance)

  • PCR amplify the deletion cassette and transform into yeast using lithium acetate method

  • Select transformants on plates containing the appropriate antibiotic

  • Verify deletions by PCR using primers that bind outside the targeted region

For the double mutant Δypc1Δydc1, the process is repeated sequentially with different selectable markers. Verification should include both molecular confirmation (PCR) and phenotypic verification, such as testing heat sensitivity for Δydc1 strains . The resulting Δypc1Δydc1 strain provides an ideal background for heterologous expression studies as it lacks all endogenous ceramidase activity .

What are the optimal conditions for measuring YDC1 activity in vitro?

For accurate measurement of YDC1 activity in vitro, the following methodological approach is recommended:

  • Prepare membrane fractions from yeast cells by ultracentrifugation (100,000g for 1 hour) of post-nuclear cell lysates in buffer containing 25mM Tris-HCl (pH 7.4) and 0.25M sucrose

  • Resuspend membrane pellets in reaction buffer (25mM Tris, pH 7.4, 5mM CaCl₂, and 150mM NaCl) by brief sonication

  • Use dihydroceramide as the primary substrate due to YDC1's preference for this molecule

  • For fluorescent detection, NBD-labeled dihydroceramide substrates can be employed

  • Conduct reactions at alkaline pH (optimal around pH 9.0-9.4)

  • Incubate at 37°C for 30 minutes and terminate reactions by adding chloroform/methanol (1:1)

  • Analyze reaction products by HPLC or thin-layer chromatography

Control experiments should include heat-inactivated enzymes and samples from Δydc1 strains to establish baseline levels and confirm specificity.

How can I express and purify recombinant YDC1 for in vitro studies?

Expressing and purifying functional recombinant YDC1 requires careful consideration of the protein's membrane-associated nature. A recommended protocol includes:

  • Clone the YDC1 open reading frame into an expression vector with an inducible promoter (GAL1 is commonly used in yeast) and an affinity tag (e.g., FLAG or His₆)

  • Transform the construct into a Δypc1Δydc1 background to eliminate interference from endogenous ceramidases

  • Induce expression with galactose in appropriate media (e.g., SC-Ura with 2% galactose for plasmids with URA3 markers)

  • Harvest cells in log phase (OD₆₀₀ ≈ 1.0) and prepare membrane fractions as described above

  • Solubilize membranes with mild detergents (e.g., 0.5% Triton X-100 or 1% CHAPS)

  • Purify using affinity chromatography corresponding to the tag used

  • Verify purification by Western blot analysis with appropriate antibodies

For functional studies, it's crucial to maintain the protein in an appropriate detergent environment throughout the purification process to preserve enzymatic activity.

How does YDC1 contribute to sphingolipid homeostasis in yeast?

YDC1 plays a specific role in sphingolipid metabolism by regulating dihydroceramide levels. The enzyme's activity affects downstream metabolites in the sphingolipid pathway, potentially influencing complex sphingolipids like inositolphosphorylceramides. Interestingly, ceramide levels in Δypc1Δydc1 cells remain normal even in the presence of aureobasidin A, an inhibitor of inositolphosphorylceramide synthase . This suggests alternative mechanisms for maintaining ceramide homeostasis when ceramidase activity is absent.

The distinct substrate preferences of YDC1 (dihydroceramide) and YPC1 (phytoceramide) likely reflect their involvement in different branches of the sphingolipid metabolic pathway. YDC1's role in heat stress response indicates that dihydroceramide or its metabolites may function as signaling molecules during stress conditions. This presents an interesting area for further investigation into stress-responsive signaling pathways in yeast.

How can the Δypc1Δydc1 double mutant be used as a tool for heterologous ceramidase studies?

The Δypc1Δydc1 double mutant strain provides an exceptional system for studying ceramidases from other organisms due to its lack of endogenous ceramidase activity . This creates a "clean" background for heterologous expression studies. The methodology for utilizing this system includes:

  • Transform Δypc1Δydc1 cells with an expression vector containing the ceramidase gene of interest under an inducible promoter

  • Induce expression with appropriate conditions (e.g., galactose for GAL promoters)

  • Prepare total membranes from the transformed cells

  • Measure ceramidase activity using appropriate substrates

  • Compare activity profiles against known substrates to characterize substrate specificity

This approach has been successfully employed to study human ACER3, demonstrating the versatility of the system . The clean background provided by the Δypc1Δydc1 strain offers superior signal-to-noise ratio for detecting even low levels of ceramidase activity from heterologously expressed enzymes.

What is known about the bidirectional activity of YDC1?

The reverse ceramide synthase activity becomes particularly relevant under specific stress conditions. For example, overexpression of YDC1 can suppress growth inhibition by fumonisin B1 (a ceramide synthase inhibitor), albeit more modestly than YPC1 overexpression . This indicates that the reverse activity may serve as a compensatory mechanism when the primary ceramide synthesis pathway is compromised.

How do YDC1 and YPC1 compare to mammalian alkaline ceramidases?

YDC1 and YPC1 share functional similarity with mammalian alkaline ceramidases but exhibit distinct substrate specificities. Unlike mammalian alkaline ceramidases that can hydrolyze unsaturated ceramides, neither YDC1 nor YPC1 can hydrolyze unsaturated mammalian-type ceramides . The table below summarizes key differences:

FeatureYDC1YPC1Mammalian Alkaline Ceramidases
Preferred substrateDihydroceramidePhytoceramideVaries by isoform (ACER1-3)
Activity on unsaturated ceramidesNoneNonePresent (especially ACER2/3)
Reverse activityMinimalPresentLimited
Cellular locationEarly secretory pathwayEarly secretory pathwayER/Golgi complex
Role in stress responseHeat stressLess definedVarious stress responses

This comparison highlights the specialized evolution of yeast ceramidases compared to their mammalian counterparts, likely reflecting differences in sphingolipid composition between yeast and mammals.

What structural features determine YDC1's substrate specificity?

While detailed crystal structures for YDC1 are not available in the provided search results, functional studies suggest several key structural determinants of substrate specificity:

  • The enzyme's active site likely accommodates the saturated dihydrosphingosine backbone of dihydroceramide more efficiently than the hydroxylated phytosphingosine backbone of phytoceramide

  • Amino acid residues in the catalytic domain must recognize specific structural features that differentiate dihydroceramide from phytoceramide

  • The inability to hydrolyze unsaturated ceramides suggests structural constraints that prevent proper binding of substrates with double bonds in the sphingoid base

Comparative studies with human alkaline ceramidases have identified critical residues for catalytic activity, including histidine residues (H81, H217, H221) and aspartic acid (D92) . Similar conserved residues likely play crucial roles in YDC1's catalytic mechanism and substrate recognition.

What are the most effective methods for studying YDC1 interactions with other proteins?

Investigating YDC1's protein-protein interactions requires approaches that preserve membrane protein associations. Recommended methodologies include:

  • Affinity purification coupled with mass spectrometry (AP-MS)

    • Express YDC1 with an affinity tag (FLAG, HA, etc.)

    • Cross-link proteins if necessary to capture transient interactions

    • Purify under mild conditions to maintain protein complexes

    • Identify interacting partners by mass spectrometry

  • Split-ubiquitin yeast two-hybrid system

    • Specifically designed for membrane proteins

    • Allows detection of interactions in their native membrane environment

    • Can be used for screening libraries to identify novel interactors

  • Bimolecular Fluorescence Complementation (BiFC)

    • Visualize interactions in living cells

    • Provides spatial information about where interactions occur

    • Can detect weak or transient interactions

These approaches should be complemented with biochemical validation and functional studies to confirm the biological relevance of identified interactions.

How can contradictions in YDC1 activity data between in vivo and in vitro studies be reconciled?

Discrepancies between in vivo and in vitro observations of YDC1 activity highlight important considerations for experimental design. For example, Ypc1p shows preference for C24 and C26 fatty acids as substrates when working as a ceramide synthase in vivo, but prefers C16:0 when solubilized in detergent and working in vitro . Similar discrepancies might exist for YDC1.

To reconcile such contradictions, researchers should:

  • Consider the lipid environment effects on enzyme activity

    • Native membranes vs. detergent micelles

    • Lipid composition influences on enzyme conformation

    • Potential for substrate channeling in intact membranes

  • Evaluate protein-protein interactions that may modify activity

    • Regulatory proteins present in vivo but absent in vitro

    • Complex formation that affects substrate accessibility

  • Examine post-translational modifications

    • Modifications present in vivo may be lost during purification

    • Activity differences may reflect different modification states

The contradictions themselves provide valuable insights into the contextual regulation of YDC1 activity and should be viewed as opportunities to discover novel regulatory mechanisms.

What are the most promising research directions for YDC1 studies?

Future research on YDC1 would benefit from focusing on:

  • Detailed structural studies to elucidate the molecular basis of substrate specificity

  • Investigation of YDC1's role in stress signaling networks beyond heat stress

  • Exploration of potential therapeutic applications of inhibiting or enhancing YDC1-like activities in pathogenic fungi

  • Comparative studies across fungal species to understand evolutionary conservation and divergence

  • Systems biology approaches to map YDC1's position within the broader sphingolipid regulatory network

The relatively mild phenotypes of YDC1 deletion under standard conditions but specific stress-related phenotypes suggest important conditional functions that warrant further investigation . Additionally, the use of Δypc1Δydc1 strains as expression systems for heterologous ceramidases opens numerous possibilities for comparative enzymology studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.