Recombinant Saccharomyces cerevisiae Alkaline ceramidase YPC1 (YPC1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant YPC1 is a 316-amino acid protein expressed in Escherichia coli with an N-terminal His-tag for purification . Key structural and biochemical properties include:

PropertyDetail
GeneYPC1 (YBR183w)
UniProt IDP38298
Molecular Weight~35 kDa (calculated)
Expression HostEscherichia coli
TagHis-tag (N-terminal)
Activity pH OptimumAlkaline (pH 9.4)
SubstratesDihydroceramide, phytoceramide (not unsaturated mammalian ceramide)

Functional Properties

YPC1 exhibits unique catalytic duality:

Hydrolysis Activity

  • Cleaves dihydroceramide and phytoceramide into sphingosine and free fatty acids .

  • Resistant to fumonisin B1, a fungal toxin that inhibits CoA-dependent ceramide synthases .

Synthesis Activity

  • Catalyzes CoA-independent formation of phytoceramide from palmitic acid and phytosphingosine .

  • Critical for maintaining sphingolipid homeostasis under stress conditions .

Substrate Specificity

EnzymePreferred SubstrateReverse Activity
YPC1PhytoceramideYes (phytoceramide synthesis)
YDC1DihydroceramideMinimal

Catalytic Mechanism

YPC1 belongs to the CREST superfamily of Zn²⁺-dependent amidases. Key residues (His81, His217, Asp92, Ser77) form a conserved catalytic triad essential for activity :

  • Zn²⁺ Coordination: His81, His217, and Asp92 bind Zn²⁺, stabilizing the transition state during hydrolysis .

  • Ser77 Role: Acts as a nucleophile; mutation to alanine (S77A) reduces activity by 600-fold .

  • pH Sensitivity: Optimal activity at pH 9.4 due to deprotonation of active-site residues .

Kinetic Parameters

Kinetic studies using Δypc1Δydc1 yeast mutants (lacking endogenous ceramidase activity) reveal:

SubstrateK<sub>M</sub> (μM)V<sub>max</sub> (pmol/min/mg)
NBD-C<sub>12</sub>-PHC15.48 ± 1.2546.94 ± 0.90
DihydroceramideNot reportedModest activity

Research Applications

Recombinant YPC1 is utilized in:

  • Sphingolipid Metabolism Studies: Investigating ceramide turnover and its role in apoptosis, stress responses, and fungal toxin resistance .

  • Enzyme Engineering: Site-directed mutagenesis (e.g., H81A, D92A) to dissect catalytic mechanisms .

  • Biochemical Assays:

    • In vitro ceramidase activity: Measured via HPLC or TLC using fluorescent substrates .

    • Heat stress models: Δypc1 mutants show sensitivity to heat, implicating dihydroceramide in stress adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YPC1; YBR183W; YBR1305; Alkaline ceramidase YPC1; Acyl-CoA-independent ceramide synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPC1
Target Protein Sequence
MGIFRWNYPESSVPGVWGETTSTIDWCEENYVVSPYIAEWSNTLTNSVFILSAIYTTYSA YKNKLEKRFLLIGFGYGLVGVGSWLFHMTLKYRFQLLDELPMIYAMCIPTWSLVCEAKEA LLNGDNHKKVPLFEQIFIGVIIGLAVTTASILYVIYKNVDIHQILFGVQIVVVAATAGSL TYRYVHDPLAKRNLKASMALGAILFLSGYISWLLDIHYCSFWVHVRRSILALPLGVLLEP HGWWHILTGMGIYFYIVSLEHLRVITLNVSCNYQFIWRWKVFPELIWKGRKPSTRYSLEL FGPYVEDQSIEVKKEK
Uniprot No.

Target Background

Function
Alkaline ceramidase that hydrolyzes phytoceramide and dihydroceramide into phytosphingosine or dihydrosphingosine. It exhibits a preference for phytoceramide. This enzyme also possesses reverse activity as an acyl-CoA-independent ceramide synthase, catalyzing the synthesis of phytoceramide and dihydroceramide from palmitic acid and phytosphingosine or dihydrosphingosine. It is not responsible for the breakdown of unsaturated ceramide. In vivo, it preferentially utilizes very long chain fatty acids (C-24 and C-26) compared to C-16 in vitro.
Gene References Into Functions
  1. Ceramides of ypc1ydc1 remained normal even in the presence of aureobasidin A, an inhibitor of inositolphosphorylceramide synthase. PMID: 24866405
  2. Sphingolipid homeostasis is investigated through the determination of membrane topology of the conserved residues of Ypc1. PMID: 23445175
Database Links

KEGG: sce:YBR183W

STRING: 4932.YBR183W

Protein Families
Alkaline ceramidase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is YPC1 and what is its primary function in yeast cells?

YPC1 (YBR183w) encodes an alkaline ceramidase in Saccharomyces cerevisiae that catalyzes the breakdown of dihydroceramide and phytoceramide, but not unsaturated ceramide . Interestingly, YPC1p also possesses reverse activity, functioning as a ceramide synthase that catalyzes the synthesis of phytoceramide from palmitic acid and phytosphingosine . This dual functionality makes YPC1 a unique player in sphingolipid homeostasis, allowing it to both degrade and synthesize specific ceramide species depending on cellular conditions.

How does YPC1 differ structurally and functionally from its paralog YDC1?

YPC1 and YDC1 are highly homologous yeast alkaline ceramidases that arose from whole genome duplication . Despite their homology, they display distinct substrate preferences. While both are located in the early secretory pathway, YPC1 preferentially hydrolyzes phytoceramide, whereas YDC1 has higher activity toward dihydroceramide . Additionally, YPC1 possesses strong reverse ceramide synthase activity that is CoA-independent and fumonisin B1-resistant, a characteristic that distinguishes it from conventional ceramide synthases . This functional divergence likely represents an evolutionary adaptation that allows more nuanced regulation of the sphingolipid metabolic network.

What are the key experimental methods for confirming YPC1 ceramidase activity?

Confirmation of YPC1 ceramidase activity requires multiple complementary approaches:

  • Heterologous expression systems: YPC1 enzymatic activity can be validated by expressing the gene in Escherichia coli followed by in vitro enzyme assays using purified protein and appropriate ceramide substrates .

  • Radiolabeled substrate assays: Utilizing radiolabeled ceramides (typically ³H or ¹⁴C-labeled) to measure breakdown products through thin-layer chromatography or HPLC.

  • Overexpression and deletion studies: Comparing sphingolipid profiles in wild-type, YPC1 overexpression, and YPC1 deletion strains using mass spectrometry-based lipidomics .

  • Fumonisin B1 resistance assays: Testing growth in the presence of this mycotoxin, as YPC1 overexpression confers resistance to fumonisin B1, an inhibitor of classical ceramide synthases .

How does YPC1 contribute to cellular sphingolipid homeostasis?

YPC1 plays a dual role in sphingolipid homeostasis through its bidirectional enzymatic activity. As a ceramidase, it breaks down phytoceramide and dihydroceramide, potentially reducing ceramide levels during certain stress conditions . Conversely, through its reverse ceramide synthase activity, YPC1 can generate phytoceramide through a CoA-independent mechanism that bypasses the conventional ceramide synthesis pathway . This reversible activity provides cells with metabolic flexibility to adjust ceramide levels in response to changing environmental conditions.

What is the relationship between YPC1 activity and ceramide-mediated cellular processes?

Ceramide acts as an important modulator of various cellular events including apoptosis, cell cycle arrest, senescence, differentiation, and stress responses . YPC1, through its ability to both generate and degrade ceramides, potentially influences these ceramide-mediated processes. In particular:

  • Stress responses: YPC1 conveys relative resistance toward H₂O₂, suggesting a role in oxidative stress management .

  • Chronological aging: Under caloric restriction conditions, Ypc1p reduces chronological life span, indicating a complex role in longevity regulation .

  • Membrane homeostasis: As ceramides are precursors to complex sphingolipids that regulate membrane biophysical properties, YPC1 activity may indirectly affect membrane fluidity and microdomain organization.

The precise mechanisms by which YPC1 influences these processes remain areas of active investigation, particularly given its seemingly redundant function with YDC1 under standard laboratory conditions.

What are the optimal conditions for expressing and purifying recombinant YPC1 for in vitro studies?

Expression System Selection:

  • E. coli systems: While demonstrated successful for confirming enzymatic activity , E. coli lacks eukaryotic post-translational modifications. Optimal results require codon optimization and use of strains like BL21(DE3) with T7 expression systems.

  • Yeast expression systems: S. cerevisiae or Pichia pastoris offer advantages for proper folding and post-translational modifications of YPC1.

Purification Protocol:

  • Affinity chromatography using His-tag or GST-tag fusions represents the primary purification method

  • Detergent selection is critical - typically CHAPS or n-dodecyl-β-D-maltoside (DDM) at 0.1-0.5% concentrations

  • Buffer optimization (typically 50 mM Tris-HCl, pH 7.5-8.0, 150 mM NaCl)

  • Stabilizing agents (10-20% glycerol) to maintain enzyme activity

Activity Preservation:
The enzymatic activity of purified YPC1 is highly sensitive to detergent concentration and pH. Maximum ceramidase activity occurs at alkaline pH (pH 8.0-9.5), while ceramide synthase activity may have different optimal conditions .

How can researchers effectively measure both ceramidase and ceramide synthase activities of YPC1?

Ceramidase Activity Assay:

ComponentConcentrationPurpose
Purified YPC11-5 µgEnzyme source
Dihydroceramide/Phytoceramide50-100 µMSubstrate
Buffer (Tris-HCl, pH 8.5)50 mMMaintain alkaline pH
NaCl150 mMIonic strength
CaCl₂0.5-1 mMCofactor
Triton X-1000.1%Substrate solubilization

Incubate at 30°C for 30-60 minutes. Analyze reaction products by TLC, HPLC, or mass spectrometry to quantify free sphingoid bases released.

Ceramide Synthase Activity Assay:

ComponentConcentrationPurpose
Purified YPC11-5 µgEnzyme source
Phytosphingosine50 µMSubstrate
Palmitic acid or stearic acid50-100 µMSubstrate
Buffer (HEPES, pH 7.4)25-50 mMMaintain appropriate pH
NaCl150 mMIonic strength
Triton X-1000.1%Substrate solubilization

Incubate at 30°C for 60-120 minutes. Extract lipids and analyze ceramide formation by mass spectrometry .

Important Methodological Considerations:

  • In vitro, YPC1 shows preference for C16:0 fatty acids, while in vivo it prefers C24 and C26 fatty acids as substrates .

  • The assays should include controls with heat-inactivated enzyme.

  • Fumonisin B1 can be added to confirm the CoA-independent ceramide synthase activity of YPC1 .

What advanced genetic manipulation techniques are most effective for studying YPC1 function?

CRISPR-Cas9 Genomic Editing:
For precise modification of YPC1 (site-directed mutagenesis, domain deletion, promoter modification) without introducing selection markers.

Anchor Away System:
For conditional depletion of YPC1 from specific cellular compartments to study compartment-specific functions.

Promoter Replacement Systems:

  • Tetracycline-regulated (Tet-Off/Tet-On) systems for controlled expression levels

  • Galactose-inducible promoters for strong induction

  • Methionine-repressible promoters for fine-tuned regulation

Protein Tagging Strategies:

  • C-terminal vs. N-terminal tags: Evidence suggests C-terminal tagging generally preserves YPC1 function better.

  • Tag selection:

    • Fluorescent protein fusions (GFP, mCherry) for localization studies

    • Affinity tags (TAP, FLAG, HA) for protein complex identification

    • Split-protein complementation tags for interaction studies

Selection Strategy for YPC1/YDC1 Double Mutants:
Given the minimal phenotype of individual deletions , creating double or triple mutants with additional sphingolipid pathway components may be necessary to observe clear phenotypes.

How is YPC1 activity regulated by the TORC2-Ypk1 signaling pathway?

The TORC2-dependent protein kinase Ypk1 has been identified as a regulator of YPC1 through phosphorylation . This regulatory mechanism is part of a broader cellular response to plasma membrane stress conditions. Key aspects of this regulation include:

  • Stress-responsive phosphorylation: Ypk1-dependent phosphorylation of YPC1 increases upon either sphingolipid depletion or heat shock .

  • Survival significance: This phosphorylation event is important for cell survival under stress conditions .

  • Integration with sphingolipid metabolism: TORC2-Ypk1 signaling represents a central regulator of plasma membrane lipid homeostasis, with YPC1 being one of several targets that collectively reprogram cellular processes to cope with membrane stress .

  • Regulatory network: Other targets of Ypk1 include Fpk1 (regulates aminophospholipid flippases), Orm1/Orm2 (regulates sphingolipid biosynthesis), and Gpd1 (involved in glycerophospholipid production) .

This interconnected regulatory network allows for coordinated responses to various environmental stresses, with YPC1 potentially contributing to stress adaptation through modulation of ceramide levels.

What experimental approaches can be used to study the post-translational modifications of YPC1?

Phosphorylation Analysis:

TechniqueApplicationAdvantages
Phospho-specific antibodiesWestern blottingDirect detection of specific phosphosites
Phos-tag SDS-PAGEMobility shift detectionSeparates phosphorylated from non-phosphorylated proteins
Mass spectrometryPhosphosite mappingComprehensive identification of all phosphorylation sites
Radioactive ³²P labelingIn vitro kinase assaysHighly sensitive detection of phosphorylation
Phosphomimetic mutationsFunctional analysisS/T→D/E mutations to mimic phosphorylation
Phosphonull mutationsFunctional analysisS/T→A mutations to prevent phosphorylation

Phosphorylation Site Identification:
Based on the TORC2-Ypk1 pathway connection, researchers should focus on consensus sequences recognized by Ypk1 kinase (R-x-R-x-x-S/T) when analyzing YPC1 for potential phosphorylation sites .

Other Post-translational Modifications:
Beyond phosphorylation, YPC1 may undergo additional modifications including:

  • Ubiquitination (for protein turnover regulation)

  • Glycosylation (potentially affecting localization or activity)

  • Palmitoylation (potentially affecting membrane association)

Mass spectrometry-based proteomic analysis following immunoprecipitation of tagged YPC1 remains the gold standard for comprehensive PTM profiling.

How does YPC1 contribute to cellular responses to oxidative stress?

YPC1 has been implicated in conveying relative resistance toward hydrogen peroxide (H₂O₂) , suggesting a role in oxidative stress management. The mechanisms underlying this protective effect may involve:

  • Ceramide modulation: YPC1 may help reduce pro-apoptotic ceramide species during oxidative stress.

  • Membrane integrity maintenance: By influencing sphingolipid composition, YPC1 may help maintain membrane integrity under oxidative conditions.

  • Signaling pathway crosstalk: YPC1 activity may intersect with stress-response signaling pathways, potentially through its connection to the TORC2-Ypk1 pathway .

Experimental approach to study YPC1 in oxidative stress:
Monitor survival rates, ROS levels, and lipid peroxidation in wild-type vs. YPC1 deletion/overexpression strains exposed to varying H₂O₂ concentrations. Complementary approaches include transcriptomic and lipidomic profiling to identify gene expression and lipid changes associated with YPC1's protective effect.

What is the functional significance of YPC1's substrate specificity in vivo versus in vitro?

A particularly intriguing aspect of YPC1 biology is the difference in substrate preference observed in vivo versus in vitro:

  • In vivo: YPC1 preferentially utilizes C24 and C26 fatty acids as substrates when functioning as a ceramide synthase .

  • In vitro: When solubilized in detergent, YPC1 shows preference for C16:0 fatty acids .

This difference suggests that:

  • Cellular environment effects: Membrane composition, associated proteins, or cellular cofactors may influence YPC1 substrate specificity in the native environment.

  • Physiological relevance: The preference for very-long-chain fatty acids (C24/C26) in vivo suggests YPC1 may specifically regulate a subset of ceramides with distinct biological functions.

  • Methodological implications: Researchers must exercise caution when extrapolating in vitro findings to physiological contexts.

To investigate this phenomenon, researchers could employ lipidomic profiling of cells expressing YPC1 variants with mutations affecting the substrate binding pocket, combined with in vitro assays using reconstituted membrane systems that more closely mimic the native environment.

How does YPC1 interact with other sphingolipid metabolism enzymes?

YPC1 functions within a complex network of sphingolipid metabolic enzymes, with key interactions including:

ProteinInteraction EvidenceFunctional Significance
LAG10.996 interaction score LAG1 is a ceramide synthase component involved in synthesis of ceramide from C26(acyl)-coenzyme A and dihydrosphingosine or phytosphingosine
LAC10.993 interaction score LAC1 is functionally equivalent to LAG1 in ceramide synthesis
LCB50.987 interaction score Minor sphingoid long-chain base kinase involved in synthesis of signaling molecules
LCB40.982 interaction score Sphingoid long-chain base kinase responsible for synthesis of long-chain base phosphates
SUR2High interaction score Sphingolipid C4-hydroxylase involved in hydroxylation of sphingolipids

These interactions suggest YPC1 functions within a coordinated enzymatic network that collectively regulates sphingolipid metabolism. The high interaction scores with ceramide synthase components (LAG1, LAC1) are particularly interesting given YPC1's own ceramide synthase activity, suggesting potential cooperative or competitive relationships.

What are the comparative phenotypes of YPC1 and YDC1 deletion mutants, and what do they reveal about functional redundancy?

Single deletions of either YPC1 or YDC1 have very little genetic interactions or phenotypes, suggesting functional redundancy . Even ypc1∆ydc1∆ double mutants show remarkably few phenotypes, demonstrating that ceramidase activity is not required for cell growth even under genetic stresses . Key observations include:

  • Chemical-genetic screens: Screens designed to find deletions/conditions that would alter the growth of ypc1∆ydc1∆ double mutants were essentially negative .

  • Sphingolipid profiles: Despite reports of abnormalities in sphingolipid biosynthesis detected by metabolic labeling, mass spectrometric lipid profiling shows no significant alterations in ypc1∆ydc1∆ cells .

  • Response to inhibitors: Ceramides of ypc1∆ydc1∆ remained normal even in the presence of aureobasidin A, an inhibitor of inositolphosphorylceramide synthase .

  • Chronological aging: In caloric restriction conditions, Ypc1p reduces chronological life span, suggesting a specific role in longevity regulation that may not be shared with YDC1 .

These findings suggest that while YPC1 and YDC1 may have overlapping functions in ceramide metabolism under standard growth conditions, they likely have distinct roles in specific physiological contexts, particularly during stress responses.

How can YPC1 be used as a tool to manipulate cellular ceramide levels in experimental systems?

YPC1's dual ceramidase/ceramide synthase activity makes it a valuable tool for experimental manipulation of ceramide levels:

Overexpression Applications:

  • Fumonisin B1 resistance: YPC1 overexpression confers resistance to this mycotoxin, allowing cultivation of cells in its presence .

  • Alternative ceramide synthesis pathway: When conventional ceramide synthesis is blocked, YPC1 provides an alternative CoA-independent route .

  • Stress response modulation: Can be used to study how altered ceramide metabolism affects responses to oxidative stress, heat shock, or other stressors .

Expression System Design:

  • Inducible promoters: Galactose-inducible or tetracycline-regulated promoters allow temporal control of YPC1 expression.

  • Subcellular targeting: Adding localization signals can direct YPC1 activity to specific cellular compartments.

  • Catalytic mutants: Mutations affecting specifically ceramidase or synthase activity allow selective manipulation of these functions.

Experimental Validation:
Monitor ceramide species using lipidomic profiling to confirm the expected changes in ceramide composition following YPC1 manipulation.

What implications does the YPC1 study in yeast have for understanding mammalian alkaline ceramidases?

Yeast alkaline ceramidases share functional similarities with mammalian counterparts, making YPC1 research valuable for understanding broader principles of ceramidase biology:

  • Evolutionary conservation: The presence of alkaline ceramidases in both yeast and humans suggests conserved fundamental functions in sphingolipid metabolism .

  • Dual functionality: The reverse ceramide synthase activity of YPC1 raises the possibility that mammalian ceramidases might possess similar bidirectional catalytic capabilities.

  • Stress response roles: YPC1's involvement in oxidative stress resistance may inform studies of mammalian ceramidases in stress-related pathologies .

  • Regulatory mechanisms: Understanding how YPC1 is regulated by kinase-mediated phosphorylation may provide insights into similar regulatory mechanisms in mammalian systems .

  • Redundancy and specialization: The functional redundancy observed between YPC1 and YDC1, combined with their distinct substrate preferences, parallels the multiple ceramidase isoforms in mammals that show both overlapping and specialized functions.

Translational research should focus on determining whether mammalian alkaline ceramidases possess reverse ceramide synthase activity similar to YPC1, and whether they respond to stress conditions through comparable regulatory mechanisms.

What are the key unresolved questions about YPC1 that warrant further investigation?

Despite significant advances in understanding YPC1, several important questions remain:

  • Structural basis of dual activity: What structural features enable YPC1 to catalyze both ceramidase and ceramide synthase reactions? Crystal structure determination would provide valuable insights.

  • Physiological triggers: What cellular conditions determine whether YPC1 functions predominantly as a ceramidase or ceramide synthase in vivo?

  • Substrate specificity mechanisms: What molecular mechanisms explain the difference in fatty acid preference observed in vivo (C24/C26) versus in vitro (C16:0) ?

  • Regulatory network: How is YPC1 integrated into broader cellular signaling networks beyond the TORC2-Ypk1 pathway ?

  • Evolutionary advantage: Given the minimal phenotype of ypc1∆ydc1∆ double mutants under standard conditions , what selective pressures have maintained these genes throughout evolution?

  • Oxidative stress protection: Through what specific mechanisms does YPC1 confer resistance to hydrogen peroxide ?

What emerging technologies might enable breakthroughs in YPC1 research?

Several cutting-edge technologies offer promise for advancing our understanding of YPC1:

  • Cryo-electron microscopy: For determining the high-resolution structure of YPC1, potentially capturing different conformational states associated with ceramidase versus ceramide synthase activities.

  • Single-molecule enzymology: To directly observe the kinetics of individual YPC1 molecules, potentially revealing mechanistic insights into its dual functionality.

  • Advanced lipidomics: Improved mass spectrometry techniques with higher sensitivity for detecting changes in low-abundance ceramide species affected by YPC1 activity.

  • Synthetic biology approaches: Engineering of minimal sphingolipid pathways incorporating YPC1 in heterologous systems to study its function in isolation from compensatory mechanisms.

  • Proximity labeling proteomics: BioID or APEX2-based approaches to identify transient interactors and the broader interaction network of YPC1 in living cells.

  • Microfluidics and high-throughput screening: For identifying chemical modulators of YPC1 activity or genetic interactions under various stress conditions.

  • Integrative multi-omics: Combining transcriptomics, proteomics, and lipidomics to develop comprehensive models of YPC1's role in cellular homeostasis.

What are the best practices for designing experiments with recombinant YPC1?

Researchers working with recombinant YPC1 should consider these best practices:

  • Expression system selection: Choose an expression system appropriate for your experimental goals. While E. coli systems are suitable for basic enzymatic studies , yeast expression systems may better preserve native regulatory features.

  • Activity validation: Always confirm both ceramidase and ceramide synthase activities using appropriate substrates, as activity can be affected by expression conditions and purification methods.

  • pH considerations: Remember that YPC1 is an alkaline ceramidase, with optimal ceramidase activity at pH 8.0-9.5.

  • Control experiments: Include appropriate controls including inactive enzyme preparations and parallel experiments with related enzymes like YDC1.

  • Substrate selection: Be aware of the different substrate preferences observed in vivo versus in vitro , and design experiments accordingly.

  • Detergent effects: When working with purified YPC1, carefully optimize detergent type and concentration, as these can significantly affect activity and substrate specificity.

  • Reproducibility considerations: Document all experimental conditions meticulously, as small variations in buffer composition, temperature, or protein preparation can impact YPC1 activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.