Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae Altered Inheritance of Mitochondria Protein 11 (AIM11)

Saccharomyces cerevisiae, commonly known as baker's yeast, is a widely studied eukaryotic microorganism in genetics, cell biology, and biotechnology . Recombinant Saccharomyces cerevisiae expressing Altered Inheritance of Mitochondria protein 11 (AIM11) involves the genetic modification of S. cerevisiae to produce the AIM11 protein, a component involved in mitochondrial inheritance . AIM11, also known as mitochondrial protein Aim23, is a mitochondrial translation initiation factor .

AIM11 Protein Function and Characteristics

AIM11 is involved in mitochondrial translation initiation . Disruption of AIM23 in S. cerevisiae results in an imbalance in mitochondrial protein production, increasing the synthesis of the Atp9 subunit of F1F0 ATP synthase while repressing the expression of Cox1, Cox2, and Cox3 subunits of cytochrome c oxidase . AIM11 is essential for mitochondrial functionality in S. cerevisiae .

Recombinant AIM11 protein is produced in E. coli as a full-length protein (1-137aa) fused to an N-terminal His tag .

Methods for Generating Recombinant Saccharomyces cerevisiae AIM11

  • Genetic Transformation: Introducing a plasmid containing the AIM11 gene into S. cerevisiae cells .

  • Biolistic Transformation: Using microprojectile bombardment to deliver DNA into yeast mitochondria .

  • Homologous Recombination: Employing the yeast's recombination machinery to integrate the AIM11 gene into the mitochondrial genome .

Effects of AIM23 Disruption on Saccharomyces cerevisiae

Disruption of AIM23 affects S. cerevisiae growth on non-fermentable carbon sources and mitochondrial functionality . While AIM23-deficient strains can form colonies on glycerol and ethanol, growth is significantly slower compared to parental strains .

Applications of Recombinant Saccharomyces cerevisiae AIM11

  • Vaccine Development: S. cerevisiae expressing tumor-associated antigens protects against tumor challenge .

  • Study of Mitochondrial Biology: Recombinant S. cerevisiae allows for defined alterations in mtDNA, providing tools for studying mitochondrial biology .

  • Understanding Mitophagy: Investigating the relationship between aminoglycoside stress and mitochondrial dysfunction using cybrid cell lines .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol utilizes 50% glycerol; this serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To ensure a specific tag, please inform us; we will prioritize its development.
Synonyms
AIM11; GEP8; SCY_1597; Altered inheritance of mitochondria protein 11; Genetic interactor of prohibitins 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
AIM11
Target Protein Sequence
MIEEKKERKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKYVPSIFQQNYKLPPFSQRN EAMSALTYASAASIGTFSTLIFGFCWALDISTAREFVFKTREFMGVPQALETDTSMDEET SKLTKQLQDLLSSENNK
Uniprot No.

Target Background

Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are AIM proteins in Saccharomyces cerevisiae and what is their relationship to mitochondrial function?

AIM proteins (Altered Inheritance of Mitochondria) in Saccharomyces cerevisiae constitute a family of proteins involved in mitochondrial function and inheritance. Within this family, recent research has characterized several members including Aim18p (encoded by YHR198C) and Aim46p (encoded by YHR199C) as chalcone isomerase (CHI) domain-containing proteins that localize to the mitochondrial inner membrane. Unlike plant CHIs involved in flavonoid biosynthesis, these yeast proteins have evolved distinct functions despite retaining the CHI fold. Specifically, they lack the catalytic activity of plant CHIs and instead bind heme, suggesting a potential role in mitochondrial respiratory functions or heme metabolism. These proteins are broadly conserved across the fungal kingdom, indicating their fundamental importance in fungal mitochondrial biology .

How are AIM proteins typically localized and what techniques are used to determine their subcellular location?

The subcellular localization of AIM proteins can be determined through a combination of biochemical and microscopy techniques. For proteins like Aim18p and Aim46p, researchers have employed:

  • Proteinase K protection assays: This technique helps determine whether proteins are protected within mitochondrial membranes or exposed to the cytosol

  • Sodium carbonate extractions: Used to distinguish between peripheral and integral membrane proteins

  • Fluorescence microscopy with mitochondrial markers: Enables visualization of protein localization

These approaches have confirmed that Aim18p and Aim46p reside specifically in the mitochondrial inner membrane as integral membrane proteins . For studying mitochondrial morphology in relation to AIM protein function, researchers have used fluorescent markers like Ilv3-RFP (a mitochondrial matrix protein) to visualize mitochondrial networks, allowing classification of mitochondrial morphologies (tubular, vesicular, or globular) that correlate with different cellular states .

What structural features characterize AIM proteins and how do they differ from homologous proteins in other organisms?

AIM proteins like Aim18p and Aim46p possess several distinctive structural features:

Structural FeatureDescriptionFunctional Implication
CHI foldConserved protein fold similar to plant chalcone isomerasesProvides basic structural framework
Fungal-specific loopAdditional loop structure unique to fungal homologsMay contribute to fungal-specific functions
Modified active siteLack certain key catalytic residues present in plant CHIsResults in loss of chalcone isomerase activity
Heme-binding capabilityAbility to bind heme groupsSuggests potential roles in respiratory functions

Crystal structures have revealed that while these proteins adopt the CHI fold, they lack the catalytic residues required for chalcone isomerase activity. Instead, they have evolved the ability to bind heme, distinguishing them functionally from both plant CHIs and other CHI-like proteins that bind fatty acids. This structural adaptation represents an interesting case of evolutionary repurposing of a protein fold for a distinct biochemical function .

How does posttranslational modification regulate AIM protein function during the cell cycle?

While specific data on AIM11 posttranslational modifications is not available, research on related proteins in S. cerevisiae provides valuable insights into potential regulatory mechanisms. For instance, Ecm11, another yeast protein involved in meiosis, is regulated by SUMO (Small Ubiquitin-like Modifier) modification. This sumoylation occurs specifically during meiosis and directly impacts Ecm11's function in meiotic processes related to DNA replication and crossing over. The sumoylation occurs at a specific lysine residue (Lys5), and mutations at this site impair meiotic function .

By analogy, AIM proteins may undergo similar cell cycle-specific posttranslational modifications that regulate their activity. Research approaches should include:

  • Immunoprecipitation followed by mass spectrometry to identify modifications

  • Site-directed mutagenesis of potential modification sites

  • Cell cycle synchronization experiments to determine temporal patterns of modifications

  • Phenotypic analysis of modification site mutants

These approaches would help establish whether AIM proteins undergo sumoylation, phosphorylation, or other modifications that modulate their activity throughout mitosis and meiosis .

What is the relationship between mitochondrial morphology dynamics and AIM protein function?

Mitochondrial morphology in S. cerevisiae undergoes dramatic reorganization depending on cellular state, which may correlate with AIM protein function. Research has shown that:

  • Quiescent yeast cells display numerous small vesicular mitochondria

  • Senescent cells exhibit few globular mitochondria

  • Proliferating cells maintain tubular mitochondrial networks

These morphological states correlate with cellular functions and proliferative capacity. Cells with globular mitochondria are respiratory deficient and unable to grow on non-fermentable carbon sources, whereas cells with vesicular mitochondria retain their ability to resume proliferation. This relationship between mitochondrial morphology and cellular state suggests that proteins involved in mitochondrial inheritance, including AIM family proteins, may regulate transitions between these morphological states .

Experimental approaches to study this relationship should include:

  • Time-lapse microscopy of fluorescently-tagged mitochondria in wild-type and AIM protein mutants

  • Correlation of mitochondrial morphology with cell cycle phases

  • Assessment of cellular re-entry into proliferation based on mitochondrial morphology

Such studies would help determine whether AIM proteins actively regulate mitochondrial morphology or respond to morphological changes driven by other factors .

What evolutionary relationships exist between fungal AIM proteins and how have they functionally diverged?

Phylogenetic analysis reveals that fungal CHI domain-containing proteins like Aim18p and Aim46p form a distinct outgroup from plant CHI proteins. Within the Saccharomyces genus, Aim18p and Aim46p likely arose from a tandem gene duplication event. Despite significant sequence divergence following this duplication, both proteins retain the CHI domain structure .

The evolutionary history of these proteins suggests:

  • Ancestral CHI-like proteins may have been hemoproteins

  • The CHI fold has been repurposed multiple times during evolution

  • Gene duplication allowed functional specialization of paralogs

In some species like Saccharomyces arboricola, evidence suggests fusion of these paralogs occurred, as indicated by differential phylogenetic affinities between 5' and 3' ends of the gene. Broader analysis across more than 1000 fungal genomes demonstrates conservation of these proteins throughout the fungal kingdom, underscoring their fundamental importance .

Future research should investigate the functional consequences of this evolutionary divergence by comparing biochemical properties and mitochondrial functions of homologs from diverse fungal lineages.

What techniques are most effective for analyzing AIM protein localization and membrane association?

Based on successful approaches with related proteins, researchers studying AIM proteins should consider:

TechniqueApplicationAdvantages
Proteinase K protection assaysDetermine protein topology within membranesDistinguishes exposed vs. protected protein domains
Sodium carbonate extractionsAssess membrane integrationDifferentiates between peripheral and integral membrane proteins
Fluorescence microscopyVisualize subcellular localizationProvides spatial information in intact cells
Subcellular fractionationBiochemically isolate mitochondriaEnables biochemical analysis of purified organelles
Immunogold electron microscopyUltra-high resolution localizationPrecisely localizes proteins within mitochondrial subcompartments

For membrane topology studies, researchers have successfully used proteinase K treatment of isolated mitochondria to determine which protein domains are accessible from the cytosolic side versus protected within the mitochondrial matrix. Sodium carbonate extraction at pH 11.5 has proven effective for distinguishing peripheral membrane proteins (which are extracted) from integral membrane proteins (which remain membrane-associated) .

How can researchers effectively study the heme-binding properties of AIM proteins?

Based on findings with Aim18p and Aim46p, which have been shown to bind heme despite lacking standard CHI activity, researchers studying other AIM family proteins should employ:

  • UV-visible spectroscopy to detect characteristic Soret bands indicative of heme binding

  • Titration experiments with hemin to determine binding affinities

  • Site-directed mutagenesis of predicted heme-binding residues

  • Structural studies (X-ray crystallography or cryo-EM) with and without bound heme

  • Functional assays to determine the physiological relevance of heme binding

These approaches would help establish whether heme binding is a conserved feature across the AIM protein family and what role this biochemical property plays in mitochondrial function .

What approaches can distinguish the phenotypic effects of different AIM protein mutations?

To effectively characterize AIM protein functions through mutational analysis, researchers should implement:

  • Growth assays on fermentable versus non-fermentable carbon sources to assess respiratory function

  • Microscopy analysis of mitochondrial morphology using matrix-targeted fluorescent proteins

  • Mitochondrial DNA inheritance assays

  • Chronological and replicative lifespan measurements

  • Cell cycle synchronization and analysis of cell cycle progression

For mitochondrial morphology analysis, researchers have successfully developed automated image analysis pipelines that categorize mitochondrial morphologies based on parameters including size, shape, and circularity. For example, vesicular mitochondria can be identified using size thresholds of 0-12 pixel² with circularity between 0.85-1, while tubular mitochondria are larger (20-5000 pixel²) with circularity of 0-0.5 .

How do AIM proteins coordinate with other cellular machinery during quiescence and proliferation transitions?

The transition between quiescence and proliferation represents a critical cellular decision point in which mitochondrial function plays a key role. Research on mitochondrial morphology has shown that:

  • Quiescent cells with vesicular mitochondria remain metabolically active (as demonstrated by methylene blue staining)

  • These cells retain the ability to re-enter the cell cycle when nutrients become available

  • The capacity to exit quiescence can be tracked at the individual cell level using microscopy techniques

To investigate AIM protein roles in these transitions, researchers should:

  • Monitor AIM protein levels and localization during entry into and exit from quiescence

  • Perform epistasis analysis with known regulators of quiescence

  • Utilize mother-daughter tracking with ConA-FITC pulse staining to distinguish new growth from existing cells

  • Employ density gradient fractionation to isolate quiescent cell populations

These approaches would help determine whether AIM proteins are regulators or effectors of the quiescence-proliferation transition, and how they interact with other cellular machinery during these processes .

What genomic and proteomic approaches best capture the functional relationships between AIM proteins and their interaction partners?

To comprehensively map the functional landscape of AIM proteins, researchers should employ:

  • Synthetic genetic interaction screens to identify functional relationships

  • Proximity-based labeling techniques (BioID or APEX) to identify physical interaction partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screens with mitochondrial protein libraries

  • Comparative analysis of transcriptomes and proteomes from wild-type and AIM protein mutants

For example, the identification of an interaction between Ecm11 and the Siz2 SUMO ligase through yeast two-hybrid analysis provided important insights into the regulation mechanism of Ecm11, even though Siz2 was not essential for Ecm11 sumoylation . Similar approaches may reveal unexpected regulatory relationships for AIM proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.