Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 19, mitochondrial (AIM19)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Mitochondrial Biology

AIM19 is implicated in mitochondrial inheritance and interacts with Tim23p, a core component of the mitochondrial inner membrane translocase . Key findings include:

  • Genetic Interactions: Deletion of AIM19 in S. cerevisiae reduces respiratory growth, suggesting a role in oxidative phosphorylation .

  • Mitochondrial Import: While AIM19 is not a canonical import receptor like MOM19 , it may assist in stabilizing translocase complexes or regulating substrate specificity .

  • Structural Homology: AIM19 shares sequence homology with mitochondrial nucleoid-associated proteins (e.g., M19 in humans ), hinting at roles in mtDNA maintenance .

3.1. Biochemical Assays

Recombinant AIM19 is utilized in SDS-PAGE and binding studies to investigate its interaction partners. For example:

  • Binding Affinity: Studies using His-tagged AIM19 revealed electrostatic interactions with hydrophilic mitochondrial preproteins, analogous to ATOM46 in Trypanosoma brucei .

  • Thermal Stability: The protein retains activity up to 40°C in Tris/PBS buffer (pH 8.0) with 6% trehalose .

3.2. Genetic Complementation

  • Rescue Experiments: Expression of recombinant AIM19 in aim19Δ yeast restored wild-type mitochondrial morphology under respiratory conditions .

Comparative Analysis with Homologs

AIM19 homologs exist across eukaryotes, including Schizosaccharomyces pombe (UniProt ID: Q9UUF4) :

FeatureS. cerevisiae AIM19S. pombe AIM19 Homolog
Length157 aa119 aa
Conserved DomainsARM repeats (predicted)CS/Hsp20-like domain
LocalizationMitochondrial matrix Mitochondrial nucleoid

Future Research Directions

  • Mechanistic Studies: Resolve AIM19’s role in mitochondrial DNA-protein complex assembly using cryo-EM .

  • Industrial Applications: Engineer AIM19-overexpressing yeast for enhanced bioethanol production under stress .

References

  1. MyBioSource. Recombinant Saccharomyces cerevisiae AIM19. 2025.

  2. Creative BioMart. Recombinant AIM19 Protein. 2025.

  3. Söllner et al. Cell. 1989 .

  4. PubMed. Association of M19 with mtDNA. 2009 .

  5. PMC. Determinism in Mitochondrial Import Receptors. 2021 .

  6. BioGRID. AIM19 Genetic Interactions. 2015 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to customer needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
AIM19; YIL087C; Altered inheritance of mitochondria protein 19, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
AIM19
Target Protein Sequence
MSAKPATDDAKDELLSPFRRLYALTRTPYPALANAALLASTPVLSPSFKVPPTQSPALSI PMSRVFSKSSTARIGITTKTALFFSTMQAIGAYMIYDNDLENGAGFIATWSALYLIVGGK KSFSALRYGRTWPLVLSSVSLANAVLYGQRFLATGFQ
Uniprot No.

Target Background

Database Links

KEGG: sce:YIL087C

STRING: 4932.YIL087C

Protein Families
AIM19 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM19 and what is its basic function in Saccharomyces cerevisiae?

AIM19 (Altered inheritance of mitochondria protein 19, mitochondrial) is a mitochondrial protein in Saccharomyces cerevisiae (baker's yeast) also known as YIL087C or LRC2. It is classified as a putative protein that physically interacts with the mitochondrial import component Tim23p . The protein consists of 157 amino acids and plays a significant role in mitochondrial function and respiratory metabolism .

The basic functions of AIM19 include:

  • Involvement in mitochondrial biogenesis processes

  • Contribution to respiratory growth, as null mutants display reduced respiratory capacity

  • Potential role in cellular stress responses, particularly during endoplasmic reticulum (ER) stress

AIM19 has been identified as a high-copy suppressor of ER stress-mediated cell death, suggesting its importance in maintaining cellular homeostasis during stress conditions . While its precise molecular mechanism remains under investigation, it appears to function alongside other mitochondrial proteins such as Mrx9 and Mrm1 in promoting mitochondrial biogenesis and improving electron transport chain efficiency .

How does AIM19 contribute to mitochondrial function in yeast cells?

AIM19 contributes to mitochondrial function through several mechanisms. First, it physically interacts with Tim23p, a central component of the mitochondrial protein import machinery . This interaction suggests AIM19 may play a role in regulating mitochondrial protein import, which is crucial for maintaining proper mitochondrial function and biogenesis.

Additionally, deletion of AIM19 results in reduced respiratory growth, indicating its involvement in mitochondrial respiration . This phenotype may be related to its role in:

  • Maintaining electron transport chain efficiency

  • Contributing to mitochondrial biogenesis processes

  • Participating in stress response mechanisms that protect mitochondrial function

AIM19 has been identified as one of three mitochondrial proteins (along with Mrx9 and Mrm1) that increase mitochondrial biogenesis and serve as high-copy suppressors of ER stress-mediated cell death . This suggests that AIM19 may help coordinate mitochondrial function with cellular stress responses, particularly during ER stress, by promoting mitochondrial biogenesis and improving electron transport chain efficiency to reduce reactive oxygen species (ROS) accumulation .

What are the optimal protocols for recombinant expression and purification of AIM19?

For recombinant expression and purification of AIM19, researchers commonly utilize E. coli expression systems with appropriate tags to facilitate purification. Based on established protocols, the following methodology is recommended:

Expression System:

  • E. coli BL21(DE3) or similar strains optimized for protein expression

  • Expression vector containing the full-length AIM19 coding sequence (1-157 amino acids) with an N-terminal His-tag

  • IPTG-inducible promoter system with optimization of induction conditions (temperature, time, IPTG concentration)

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods in Tris/PBS-based buffer (pH 8.0)

  • Affinity chromatography using Ni-NTA resin to capture His-tagged AIM19

  • Washing steps with increasing imidazole concentrations to remove non-specific binding

  • Elution with high imidazole buffer

  • Size exclusion chromatography for further purification if needed

  • Final buffer exchange to Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Storage Recommendations:

  • Lyophilization or storage in solution with 50% glycerol

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Storage at -20°C/-80°C for long-term preservation

Purity assessment should be performed using SDS-PAGE, with successful preparations typically achieving >90% purity . For functional studies, protein activity assays should be established based on known interactions or predicted functions.

How can researchers design experiments to investigate AIM19's role in ER stress response?

Investigating AIM19's role in ER stress response requires carefully designed experiments that integrate genetic, biochemical, and cellular approaches. The following experimental design strategy is recommended:

Genetic Approaches:

  • Generate AIM19 deletion (aim19Δ) and overexpression strains in S. cerevisiae

  • Create point mutations in functional domains to identify critical residues

  • Implement parallel encouragement design using genetic effects as encouragement to explore causal mechanisms

ER Stress Induction Methods:

  • Tunicamycin treatment (N-linked glycosylation inhibitor)

  • DTT treatment (disrupts disulfide bond formation)

  • Thapsigargin treatment (depletes ER calcium)

  • Expression of misfolded proteins

Key Analytical Methods:

  • Cell viability assays following ER stress induction in wild-type vs. aim19Δ strains

  • Measurement of ROS accumulation using fluorescent probes (e.g., DCFDA)

  • Assessment of mitochondrial membrane potential using JC-1 or TMRM

  • Analysis of electron transport chain efficiency through oxygen consumption measurements

  • Quantification of mitochondrial biogenesis markers

Data Collection Table Template:

StrainER Stress ConditionCell Viability (%)ROS Levels (AU)O₂ Consumption (nmol/min/mg)Mitochondrial Membrane Potential (AU)
WTControl
WTTunicamycin
aim19ΔControl
aim19ΔTunicamycin
AIM19-OEControl
AIM19-OETunicamycin

Research has demonstrated that AIM19 overexpression can rescue cells from ER stress-induced death by enhancing mitochondrial biogenesis and improving electron transport chain efficiency, thereby reducing ROS accumulation . To build on these findings, researchers should investigate the specific molecular mechanisms by which AIM19 promotes these protective effects.

What techniques are most effective for studying AIM19 interactions with the Tim23 import complex?

Studying AIM19 interactions with the Tim23 import complex requires specialized techniques that capture both physical interactions and functional consequences. The following methodological approaches are recommended:

Physical Interaction Studies:

  • Co-immunoprecipitation (Co-IP) using antibodies against AIM19 or Tim23p

  • Yeast two-hybrid assays with domain mapping to identify specific interaction regions

  • Biolayer interferometry (BLI) or surface plasmon resonance (SPR) for quantitative binding kinetics

  • Proximity-based labeling techniques such as BioID or APEX to identify interaction partners in the native cellular environment

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for visualizing interactions in living cells

Functional Analysis Methods:

  • In vitro reconstitution of the protein import process using purified components

  • Import assays using isolated mitochondria from wild-type and aim19Δ strains

  • Pulse-chase experiments to assess protein import kinetics and efficiency

  • Blue native PAGE to analyze the integrity and composition of Tim23 complex in the presence/absence of AIM19

Cross-linking Strategy:

Chemical cross-linking coupled with mass spectrometry (XL-MS) can be particularly valuable for mapping the precise contact points between AIM19 and Tim23p. This approach involves:

  • Treating isolated mitochondria or purified proteins with cross-linking agents

  • Digestion of cross-linked complexes with proteases

  • Mass spectrometric analysis to identify cross-linked peptides

  • Computational modeling of interaction interfaces

How can researchers distinguish between direct and indirect effects of AIM19 on mitochondrial biogenesis?

Distinguishing between direct and indirect effects of AIM19 on mitochondrial biogenesis presents a significant analytical challenge. Researchers should employ a multi-faceted approach that combines genetic, biochemical, and systems biology techniques:

Direct Effect Assessment:

  • Chromatin immunoprecipitation (ChIP) to identify potential direct binding of AIM19 to mitochondrial DNA or nuclear genes encoding mitochondrial proteins

  • RNA-seq and proteomics analysis immediately following acute induction of AIM19 expression

  • In vitro reconstitution experiments with purified components to test direct biochemical activities

Indirect Effect Analysis:

  • Temporal analysis of transcriptional and proteomic changes following AIM19 manipulation

  • Network analysis to identify intermediary factors between AIM19 and mitochondrial biogenesis

  • Epistasis experiments with known mitochondrial biogenesis regulators

Causal Inference Methods:

  • Implementation of parallel design experiments where AIM19 (treatment) and potential mediators are independently randomized

  • Development of crossover design studies where experimental units are sequentially assigned to different AIM19 conditions

  • Statistical mediation analysis to quantify direct and indirect effects

Recent research indicates that AIM19 functions as part of a broader stress response network that links ER stress to mitochondrial function . When interpreting data, researchers should consider that AIM19 may influence mitochondrial biogenesis through multiple pathways, including:

  • Direct activation of mitochondrial biogenesis factors

  • Indirect effects via altered cellular redox state

  • Feedback mechanisms involving mitochondrial-to-nucleus signaling

  • Compensatory responses to altered mitochondrial function

What are the key considerations for analyzing AIM19 function across different cellular stress conditions?

When analyzing AIM19 function across different cellular stress conditions, researchers should consider several key factors to ensure robust and interpretable results:

Experimental Design Considerations:

  • Employ a matrix-based approach testing multiple stressors at various intensities and durations

  • Include appropriate genetic controls (deletion, wild-type, overexpression)

  • Consider potential confounding variables such as growth phase, media composition, and genetic background

  • Design time-course experiments to capture both acute and adaptive responses

Recommended Stress Conditions to Test:

  • ER stress inducers (tunicamycin, DTT, thapsigargin)

  • Oxidative stress agents (H₂O₂, paraquat, menadione)

  • Metabolic stressors (carbon source switching, nutrient limitation)

  • Mitochondrial stress (electron transport chain inhibitors, uncouplers)

Analysis Framework:

Stress TypePrimary ReadoutSecondary MeasurementsAIM19 Dependency Assessment
ER StressCell viabilityUPR activation, ROS levelsCompare WT vs. aim19Δ vs. AIM19-OE
Oxidative StressROS accumulationAntioxidant enzyme activityEffect of AIM19 levels on ROS detoxification
Metabolic StressGrowth rateRespiratory vs. fermentative metabolismAIM19 influence on metabolic adaptation
Mitochondrial StressMembrane potentialmtDNA stability, protein importAIM19 role in mitochondrial homeostasis

Interpretation Challenges:

  • Differentiate between specific and general stress responses

  • Account for compensatory mechanisms in constitutive genetic models

  • Consider the temporal dynamics of AIM19 function during stress adaptation

  • Integrate transcriptomic and proteomic data to identify core AIM19-dependent processes

What statistical approaches are recommended for analyzing complex phenotypes in AIM19 mutant studies?

Analyzing complex phenotypes in AIM19 mutant studies requires sophisticated statistical approaches that can account for multiple variables, interactions, and potential confounding factors:

Recommended Statistical Methods:

  • Mixed-effects models to account for both fixed (e.g., genotype, treatment) and random (e.g., experimental batch) effects

  • Principal component analysis (PCA) to reduce dimensionality and identify major sources of variation

  • Multiple testing correction (e.g., Benjamini-Hochberg procedure) to control false discovery rate

  • Bayesian approaches for integrating prior knowledge with experimental data

  • Machine learning techniques for identifying complex patterns in high-dimensional data

Experimental Design for Robust Statistical Analysis:

  • Include sufficient biological and technical replicates (minimum n=3 for each, preferably more)

  • Implement balanced experimental designs when possible

  • Include appropriate controls for all experimental conditions

  • Consider power analysis to determine adequate sample sizes for detecting effects of interest

Specialized Approaches for Specific Data Types:

  • Survival analysis for time-to-event data (e.g., chronological lifespan studies)

  • Multivariate analysis of variance (MANOVA) for simultaneously analyzing multiple dependent variables

  • Permutation tests for data that violates assumptions of parametric tests

  • Bootstrapping methods for generating confidence intervals with non-normal data

Causal Inference Framework:

For understanding causal relationships between AIM19 and observed phenotypes, researchers can implement experimental designs specifically developed for identifying causal mechanisms:

  • Parallel encouragement design, where genetic effects serve as encouragement

  • Crossover designs with sequential assignment to different experimental conditions

  • Mediation analysis to quantify direct and indirect effects of AIM19 on various phenotypes

When analyzing AIM19 mutant phenotypes, it's crucial to consider the interconnected nature of mitochondrial functions and to implement statistical approaches that can detect subtle effects and complex interactions across multiple cellular processes.

How might AIM19 function interact with other mitochondrial stress response pathways?

The interaction between AIM19 and other mitochondrial stress response pathways represents an important area for future investigation. Current evidence suggests several potential interaction points that warrant further study:

Key Mitochondrial Stress Response Pathways for Investigation:

  • Mitochondrial Unfolded Protein Response (UPRᵐᵗ)

  • PINK1/Parkin-mediated mitophagy

  • Mitochondrial retrograde signaling (RTG pathway)

  • Mitochondrial dynamics (fusion/fission) regulation

Research indicates that AIM19 functions alongside other mitochondrial proteins like Mrx9 and Mrm1 as high-copy suppressors of ER stress-mediated cell death . This suggests potential cooperative or complementary functions within broader stress response networks.

Proposed Research Questions:

  • Does AIM19 activation coincide with other mitochondrial stress responses during ER stress?

  • Can AIM19 modulate the intensity or duration of the UPRᵐᵗ?

  • Does AIM19 influence mitochondrial quality control through effects on mitophagy?

  • What are the genetic interactions between AIM19 and key components of other stress response pathways?

Experimental Approaches:

  • Epistasis analysis with components of other stress response pathways

  • Transcriptional profiling of stress response genes in AIM19 mutants

  • Proteomics analysis of stress-induced protein complexes containing AIM19

  • Live-cell imaging to track mitochondrial dynamics and quality control in response to AIM19 manipulation

Understanding these interactions will provide insights into how cells coordinate different stress response mechanisms and may identify potential intervention points for mitigating cellular damage during stress conditions.

What is the potential evolutionary conservation of AIM19 function across species?

The evolutionary conservation of AIM19 function across species is an intriguing question that can provide insights into fundamental aspects of mitochondrial biology and stress responses. Although AIM19 was initially identified in Saccharomyces cerevisiae, exploring potential functional homologs in other organisms is valuable:

Comparative Genomics Approach:

  • Sequence-based homology searches in different taxonomic groups

  • Structural homology analysis to identify proteins with similar folding patterns despite sequence divergence

  • Analysis of conserved protein domains and motifs that may indicate functional conservation

  • Examination of synteny and gene neighborhood conservation

Functional Conservation Testing:

  • Complementation studies with potential homologs from different species

  • Analysis of phenotypic effects of manipulating potential homologs in other model organisms

  • Comparative analysis of protein interaction networks across species

  • Investigation of stress response mechanisms in diverse organisms

Evolutionary Rate Analysis:

Examining the evolutionary rate of AIM19 compared to other mitochondrial proteins can provide insights into its functional importance and potential conservation:

ProteindN/dS RatioConservation ScoreTaxonomic Range
AIM19
Other mitochondrial proteins
Highly conserved proteins
Rapidly evolving proteins

While the specific sequence of AIM19 may not be highly conserved across distant species, the functional role in coordinating mitochondrial responses to cellular stress may be preserved through different molecular mechanisms. Understanding these evolutionary patterns can provide insights into the fundamental importance of AIM19-like functions in cellular homeostasis.

How can systems biology approaches advance our understanding of AIM19's role in cellular homeostasis?

Systems biology approaches offer powerful tools for understanding AIM19's role within the complex network of cellular homeostasis. These approaches can reveal emergent properties not evident from reductionist studies:

Multi-Omics Integration Strategies:

  • Combined analysis of transcriptomics, proteomics, and metabolomics data from AIM19 mutants

  • Flux balance analysis to model metabolic changes associated with AIM19 function

  • Network analysis to identify key interaction hubs and signaling nodes connected to AIM19

  • Temporal dynamics modeling to understand AIM19's role in adaptive responses

Computational Modeling Approaches:

  • Constraint-based models of mitochondrial function incorporating AIM19

  • Agent-based modeling of mitochondrial-ER interactions during stress

  • Machine learning approaches to predict cellular outcomes based on AIM19 status and environmental conditions

  • Dynamical systems modeling of stress response networks

Proposed Research Framework:

  • Generate comprehensive multi-omics datasets from AIM19 wild-type, deletion, and overexpression strains under various conditions

  • Develop integrated computational models incorporating known biochemical constraints

  • Identify emergent properties and testable predictions from model simulations

  • Experimentally validate key predictions to refine models iteratively

Systems biology approaches are particularly valuable for understanding AIM19's role because it appears to function at the intersection of multiple cellular processes, including ER stress response, mitochondrial biogenesis, and ROS management . By mapping the complex network of interactions and dependencies, researchers can gain insights into how AIM19 contributes to cellular resilience during stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.