Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 26, mitochondrial (AIM26)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
AIM26; YKL037W; YKL250; Altered inheritance of mitochondria protein 26, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
AIM26
Target Protein Sequence
MQTMGGEHLLLSQLKGSFFLLLLAYFFRGRSPYYARCYRRLAVTPGAITIAIAIATDSIP ALAKSKVLVSVCSHTDPCTASCNLIPFPRPFSNSLTRFLFCLGSARFCISFPCFGLSI
Uniprot No.

Target Background

Function
Plays a role in selective mitochondrial autophagy (mitophagy).
Database Links

KEGG: sce:YKL037W

STRING: 4932.YKL037W

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the role of AIM26 in mitochondrial biology of S. cerevisiae?

AIM26 belongs to a class of proteins involved in mitochondrial quality control and inheritance in Saccharomyces cerevisiae. Similar to other mitochondrial proteins identified in genome-wide screens, AIM26 likely contributes to selective mitophagy, the process by which damaged or superfluous mitochondria are degraded via autophagy. This process is essential for maintaining mitochondrial homeostasis and quality control in yeast cells . Experimental approaches to characterize AIM26 function typically involve phenotypic analysis of deletion mutants under various growth and stress conditions, particularly focusing on mitochondrial morphology, distribution, and degradation. Fluorescence microscopy using mitochondrially-targeted fluorescent proteins, such as Om45-GFP, can be employed to visualize mitochondrial dynamics in wild-type versus aim26Δ strains.

How can AIM26 deletion mutants be generated and verified?

Generation of aim26Δ mutants can be accomplished through several approaches, with homologous recombination being the traditional method in S. cerevisiae. More recently, TALEN (Transcription Activator-Like Effector Nuclease) technology has emerged as an efficient gene disruption technique. Using TALEN, you can target specific sequences within the AIM26 gene for disruption . The process involves:

  • Designing sequence-specific TALENs targeting the AIM26 gene

  • Constructing recombinant TALEN vectors using appropriate assembly kits

  • Transforming S. cerevisiae competent cells with the recombinant plasmid

  • Selecting transformants using antibiotic resistance markers

  • Verification through PCR and sequencing

Verification of successful gene disruption should involve both genomic PCR analysis and functional assays to confirm the absence of AIM26 protein. Western blot analysis using anti-FLAG or similar tags can be employed if the wild-type AIM26 is tagged .

What phenotypes are associated with AIM26 deletion or mutation?

Like other proteins involved in mitochondrial processes, aim26Δ mutants would likely exhibit specific phenotypes related to mitochondrial function and inheritance. Based on studies of similar mitochondrial proteins, these phenotypes might include:

  • Altered mitophagy during starvation or at post-log phase

  • Changes in mitochondrial morphology or distribution

  • Potential growth defects on non-fermentable carbon sources

  • Differential sensitivity to oxidative stress

To assess mitophagy defects specifically, the GFP processing assay can be employed, where mitochondrial proteins are tagged with GFP and their degradation monitored by the appearance of free GFP in the vacuole . Additionally, microscopy-based approaches monitoring the delivery of mitochondria to the vacuole using fluorescent markers provide valuable insights into potential phenotypes.

How does AIM26 interact with the core autophagy machinery during mitophagy?

Understanding the interaction between AIM26 and core autophagy machinery requires sophisticated experimental approaches. Based on studies of mitophagy-specific genes, AIM26 likely functions in a pathway that is distinct from but converges with the core ATG pathway. To investigate these interactions:

  • Perform epistasis analysis by creating double mutants (aim26Δ atgXΔ) and assessing mitophagy efficiency

  • Use proximity labeling techniques (BioID or APEX) with AIM26 as bait to identify proximal proteins

  • Conduct co-immunoprecipitation experiments followed by mass spectrometry to identify interaction partners

  • Employ yeast two-hybrid or split-GFP assays to validate direct protein-protein interactions

When analyzing these experiments, it's essential to distinguish between constitutive interactions and those that occur specifically during mitophagy induction. Comparing interaction profiles under different conditions (nutrient-rich versus starvation) can reveal condition-specific interactions that are functionally relevant .

How do environmental factors influence AIM26-mediated mitochondrial inheritance?

Environmental factors significantly impact mitochondrial inheritance patterns in Saccharomyces cerevisiae, and understanding how these factors influence AIM26 function is crucial. Based on studies of mitochondrial inheritance in yeast hybrids, several environmental conditions can be systematically tested:

Environmental FactorExperimental ConditionExpected Effect on Mitochondrial InheritanceAnalytical Method
Carbon SourceGlucose vs. Glycerol/EthanolAltered respiratory demand and mitochondrial biogenesisqPCR for mtDNA, respiration assays
Nitrogen AvailabilityRich vs. LimitedModulated autophagy/mitophagy ratesFluorescence microscopy, western blotting
TemperatureOptimal vs. Heat/Cold StressAltered mitochondrial dynamics and quality controlMicroscopy, mitochondrial function assays
Oxidative StressH₂O₂ or Paraquat TreatmentEnhanced mitochondrial damage and selective mitophagyROS detection, mitophagy assays

Each environmental condition should be tested in both wild-type and aim26Δ strains to determine if AIM26 mediates the environmental response. Additionally, fitness competition assays between strains with different mitochondrial genomes can reveal whether AIM26 influences the competitive advantage of specific mitochondrial haplotypes under varying environmental conditions .

What is the role of AIM26 in interspecies hybrid mitochondrial inheritance?

Interspecies hybrids between closely related Saccharomyces species provide a powerful system to study biased mitochondrial inheritance. To investigate AIM26's role in this process:

  • Generate hybrids between S. cerevisiae and S. paradoxus with different AIM26 alleles or deletions

  • Track mitochondrial DNA inheritance using species-specific markers

  • Analyze whether AIM26 variants influence the direction or degree of mitochondrial inheritance bias

  • Assess the fitness of resulting hybrids under various environmental conditions

Research has shown that environmental factors can significantly influence mitochondrial transmission in hybrid diploids, with inheritance patterns being strain-dependent . By manipulating AIM26 in parental strains before hybridization, you can determine whether this protein contributes to the mechanisms underlying biased inheritance. Fitness competition assays can further reveal whether AIM26-mediated inheritance patterns confer selective advantages under specific environmental conditions.

How can high-throughput screens be designed to identify AIM26 interaction partners?

Designing effective high-throughput screens to identify AIM26 interaction partners requires a systematic approach:

  • Synthetic Genetic Array (SGA) Analysis:

    • Cross aim26Δ with a genome-wide deletion collection

    • Identify synthetic lethal or synthetic sick interactions

    • These genetic interactions often indicate parallel or compensatory pathways

  • Protein-Protein Interaction Screens:

    • Implement a systematic yeast two-hybrid screen using AIM26 as bait

    • Alternatively, use protein fragment complementation assays (PCA)

    • Validate interactions using co-immunoprecipitation and mass spectrometry

  • Chemical-Genetic Profiling:

    • Expose aim26Δ mutants to a library of chemical compounds

    • Identify compounds that specifically affect aim26Δ mutants compared to wild-type

    • These compounds can reveal pathways dependent on AIM26 function

When implementing a genome-wide screen similar to those used for identifying mitophagy factors, it's crucial to include appropriate controls and validation steps . For example, known mitophagy mutants should be included as positive controls, and secondary assays should be employed to confirm primary hits.

What techniques can be used to monitor AIM26-mediated mitochondrial quality control in real-time?

Real-time monitoring of mitochondrial quality control requires sophisticated imaging and biochemical approaches:

  • Live-Cell Fluorescence Microscopy:

    • Tag AIM26 with a fluorescent protein compatible with mitochondrial localization

    • Simultaneously label mitochondria with a different fluorescent marker

    • Use time-lapse microscopy to track mitochondrial dynamics and degradation

    • Implement photobleaching or photoactivation to track specific mitochondrial subpopulations

  • Mitophagy-Specific Reporter Systems:

    • Adapt the Om45-GFP processing assay for time-resolved analysis

    • Use pH-sensitive fluorescent proteins that change signal upon delivery to the acidic vacuole

    • Implement split fluorescent protein systems that report on mitophagy-related protein interactions

  • Biochemical Approaches with Temporal Resolution:

    • Employ cycloheximide chase experiments to track mitochondrial protein turnover

    • Use quantitative mass spectrometry with SILAC or TMT labeling to measure proteome-wide changes during mitophagy induction

The Om45-GFP processing assay has been successfully used to monitor mitophagy in yeast, where the appearance of free GFP in the vacuole indicates mitochondrial degradation . This approach can be adapted for real-time analysis by collecting samples at multiple time points after inducing mitophagy.

How can CRISPR/Cas systems be optimized for studying AIM26 function in S. cerevisiae?

While TALEN technology has been successfully applied for gene disruption in S. cerevisiae , CRISPR/Cas systems offer additional flexibility for studying AIM26 function:

  • CRISPR-Based Gene Disruption:

    • Design sgRNAs targeting the AIM26 coding sequence

    • Optimize Cas9 expression for efficient cutting

    • Provide repair templates for precise gene modification

    • Screen transformants using antibiotic selection and PCR verification

  • CRISPR Interference (CRISPRi) for Conditional Regulation:

    • Use catalytically inactive Cas9 (dCas9) fused to repressive domains

    • Target the AIM26 promoter to achieve tunable repression

    • Implement inducible systems to control dCas9 expression temporally

  • CRISPR Activation (CRISPRa) for Overexpression Studies:

    • Fuse dCas9 to transcriptional activators

    • Target the AIM26 promoter to enhance expression

    • Compare phenotypes between depletion and overexpression conditions

  • Base Editing and Prime Editing for Precise Mutations:

    • Design specialized Cas9 variants to introduce specific mutations without double-strand breaks

    • Create allelic series of AIM26 variants to map structure-function relationships

When implementing CRISPR-based approaches, it's important to verify both on-target efficiency and off-target effects. Whole-genome sequencing of edited strains can identify potential off-target mutations that might confound phenotypic analysis.

How should contradictory data about AIM26 function be reconciled in research settings?

When confronted with contradictory data regarding AIM26 function, a systematic analytical approach is essential:

  • Evaluate Experimental Conditions:

    • Analyze differences in strain backgrounds, as mitochondrial phenotypes can be strain-dependent

    • Compare growth conditions, as environmental factors significantly influence mitochondrial processes

    • Assess differences in the methods used to disrupt or modify AIM26

  • Implement Orthogonal Validation Approaches:

    • When conflicting phenotypes are observed, validate using multiple independent techniques

    • If microscopy and biochemical assays yield different results, consider time resolution and sensitivity differences

    • Use complementation experiments to confirm that phenotypes are specifically due to AIM26 disruption

  • Consider Genetic Interactions and Compensatory Mechanisms:

    • Investigate potential suppressor mutations in strains with mild phenotypes

    • Analyze the genetic background for modifications in pathways that might compensate for AIM26 loss

    • Create double or triple mutants to reveal masked phenotypes

  • Quantitative Analysis Framework:

    • Implement rigorous statistical analysis for comparing experimental outcomes

    • Use meta-analysis approaches when combining data from multiple studies

    • Consider Bayesian frameworks for integrating prior knowledge with new experimental evidence

When analyzing mitophagy data specifically, it's important to distinguish between different types of mitophagy (e.g., starvation-induced versus post-log phase), as distinct mechanisms might be involved in each context .

What bioinformatic approaches can predict AIM26 function and evolutionary significance?

Bioinformatic analyses can provide valuable insights into AIM26 function and evolution:

  • Sequence-Based Analysis:

    • Perform multiple sequence alignments across fungal species to identify conserved domains

    • Use motif prediction tools to identify functional elements (e.g., mitochondrial targeting sequences)

    • Implement coevolution analysis to identify potential interaction partners

  • Structural Bioinformatics:

    • Generate protein structure predictions using AlphaFold or similar tools

    • Map conserved residues onto predicted structures to identify functional surfaces

    • Perform molecular docking simulations to predict interactions with known mitophagy components

  • Comparative Genomics:

    • Analyze the presence and sequence conservation of AIM26 across fungal species

    • Identify gene synteny patterns that might indicate functional relationships

    • Investigate gene duplication events and paralog relationships

  • Integration with Functional Genomics Data:

    • Mine existing transcriptomic datasets to identify conditions that regulate AIM26 expression

    • Analyze proteomics data for post-translational modifications of AIM26

    • Construct gene regulatory networks to position AIM26 in broader cellular pathways

By implementing these bioinformatic approaches, researchers can generate testable hypotheses about AIM26 function and evolution, guiding experimental design and interpretation of results in the context of broader mitochondrial biology.

How can quantitative phenotyping methods be used to characterize subtle AIM26-related phenotypes?

Subtle phenotypes related to AIM26 function can be challenging to detect and quantify. Advanced quantitative phenotyping methods include:

Phenotyping MethodMeasurable ParametersTechnical ConsiderationsStatistical Analysis
High-Content MicroscopyMitochondrial morphology, number, distributionRequires automated image analysis pipelinesMachine learning classification
Flow CytometryMitochondrial mass, membrane potential, ROS levelsSingle-cell resolution but limited spatial informationPopulation distribution analysis
Metabolic Flux AnalysisOxygen consumption, ATP production, metabolite levelsProvides functional readouts of mitochondrial activityTime-series analysis, metabolic modeling
Growth Rate AnalysisFitness under various conditionsHigh-throughput but indirect measure of mitochondrial functionGrowth curve fitting, competition assays
Quantitative ProteomicsProtein abundance changes, post-translational modificationsProvides molecular-level insights into processesDifferential expression analysis

When analyzing mitophagy specifically, quantitative GFP processing assays can be used to measure the rate and extent of mitochondrial degradation . By collecting samples at multiple time points and quantifying the ratio of free GFP to Om45-GFP fusion protein, researchers can detect subtle differences in mitophagy efficiency between wild-type and aim26Δ strains.

What are the most promising research directions for understanding AIM26 in the context of mitochondrial biology?

The study of AIM26 in mitochondrial biology presents several promising research directions:

  • Integration with Broader Mitochondrial Quality Control Systems:

    • Investigate how AIM26 coordinates with other mitophagy receptors and adaptors

    • Explore connections between AIM26 and mitochondrial dynamics (fission/fusion)

    • Examine relationships between AIM26 and other mitochondrial quality control pathways

  • Environmental Response and Adaptation:

    • Analyze AIM26's role in adapting mitochondrial function to changing environments

    • Investigate whether AIM26 contributes to mitochondrial inheritance bias under specific conditions

    • Explore potential roles in stress response and mitochondrial homeostasis

  • Evolutionary Perspectives:

    • Compare AIM26 function across different yeast species to understand evolutionary conservation

    • Investigate whether AIM26 contributes to species barriers through effects on mitochondrial inheritance

    • Explore potential roles in hybrid incompatibility or adaptation

  • Translational Aspects:

    • Identify potential homologs or functional equivalents in higher eukaryotes

    • Explore whether AIM26 mechanisms inform understanding of mitochondrial diseases

    • Investigate applications in metabolic engineering of yeast strains

By pursuing these research directions, scientists can contribute to a more comprehensive understanding of mitochondrial quality control and inheritance, using AIM26 as a model for studying these essential cellular processes in Saccharomyces cerevisiae and potentially beyond .

How might advances in studying AIM26 contribute to broader understanding of mitochondrial inheritance and quality control?

Advances in AIM26 research have the potential to significantly impact our broader understanding of mitochondrial biology in several ways:

  • Mechanistic Insights into Selective Mitophagy:

    • Clarify how specific mitochondrial proteins are targeted for degradation

    • Illuminate the coordination between mitophagy receptors and core autophagy machinery

    • Reveal how cells distinguish between damaged and healthy mitochondria

  • Environmental Adaptation of Mitochondrial Function:

    • Enhance understanding of how environmental stressors trigger mitochondrial quality control

    • Reveal mechanisms of mitochondrial inheritance bias in response to environmental changes

    • Uncover how mitochondrial dynamics adapt to changing metabolic demands

  • Evolutionary Implications:

    • Provide insights into the evolution of organelle quality control systems

    • Illuminate mechanisms underlying mitochondrial inheritance patterns in hybrids

    • Contribute to understanding species barriers and hybrid compatibility

  • Methodological Advancements:

    • Drive development of new tools for studying mitochondrial dynamics and degradation

    • Establish improved protocols for analyzing mitochondrial inheritance patterns

    • Create novel assays for detecting subtle phenotypes in mitochondrial function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.