Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RCF1; AIM31; SCY_4144; Respiratory supercomplex factor 1, mitochondrial; Altered inheritance of mitochondria protein 31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
RCF1
Target Protein Sequence
MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKA QYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEE TEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGKK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit crucial for growth under hypoxic conditions. It participates in the assembly of the Complex III-Complex IV supercomplex and in the recruitment of COX13 and RCF2 into cytochrome c oxidase. It may also be essential for the late-stage assembly of COX12 and COX13 subunits and for cytochrome c oxidase activity.

Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM31/Rcf1 protein in Saccharomyces cerevisiae?

AIM31 (Altered Inheritance of Mitochondria protein 31), later renamed Rcf1 (Respiratory superComplex Factor 1), is a critical component of the mitochondrial respiratory chain in Saccharomyces cerevisiae. It functions as an integral part of the mitochondrial cytochrome bc1-cytochrome c oxidase supercomplex, which is essential for cellular respiration and energy production . The protein was initially identified in a genetic screen designed to discover mutants that displayed altered inheritance patterns of mitochondrial DNA . Functionally, AIM31/Rcf1 belongs to the Hypoxia-induced Gene 1 Protein Family and plays a crucial role in maintaining the structural integrity and functional efficiency of the respiratory chain complexes.

How does AIM31 affect mitochondrial inheritance in yeast?

AIM31 influences mitochondrial inheritance through its role in maintaining the stability and proper functioning of the mitochondrial respiratory complexes. When AIM31 function is compromised, several consequences can occur:

  • Destabilization of the cytochrome bc1-cytochrome c oxidase supercomplex

  • Altered mitochondrial membrane potential

  • Changes in mitochondrial morphology and distribution

  • Disrupted segregation of mitochondria during cell division

What are the main techniques for creating recombinant S. cerevisiae expressing modified AIM31?

Several molecular biology techniques can be employed to create recombinant S. cerevisiae strains expressing modified AIM31:

CRISPR/Cas9-Based Gene Editing:
The CRISPR/Cas9 system has revolutionized gene editing in S. cerevisiae. This technique utilizes a single guide RNA (sgRNA) to target the AIM31 locus with high specificity. The Cas9 protein introduces double-strand breaks (DSBs) at the target site, which are then repaired through homologous recombination using a donor DNA template carrying the desired modifications . This approach achieves nearly 100% efficiency when properly optimized .

Homologous Recombination:
S. cerevisiae exhibits naturally high homologous recombination efficiency, making it an excellent host for genetic modifications. This property can be exploited to integrate modified AIM31 sequences into the genome without requiring CRISPR/Cas9. The technique involves designing DNA constructs with homology arms flanking the desired integration site .

Plasmid-Based Expression:
For transient or regulated expression, modified AIM31 can be cloned into yeast expression vectors under the control of constitutive or inducible promoters. This approach offers flexibility in testing various AIM31 variants before creating stable genomic integrations.

How can researchers verify successful recombinant expression of AIM31?

Verification of successful recombinant expression of AIM31 requires a multi-faceted approach:

Genetic Verification:

  • PCR amplification of the integrated construct

  • DNA sequencing to confirm the precise genetic modification

  • Restriction enzyme analysis to verify correct integration

Protein Expression Verification:

  • Western blotting using antibodies against AIM31 or epitope tags

  • Mass spectrometry to confirm protein identity and modifications

  • Immunofluorescence to determine subcellular localization

Functional Verification:

  • Respiratory growth assays on non-fermentable carbon sources

  • Mitochondrial membrane potential measurements

  • Analysis of supercomplex assembly by blue native PAGE

  • Measurement of cytochrome c oxidase activity

A comprehensive verification approach combines these methods to ensure both the presence and functionality of the recombinant AIM31 protein.

What is the relationship between AIM31 and the respiratory chain in yeast mitochondria?

AIM31/Rcf1 serves as a critical component of the mitochondrial cytochrome bc1-cytochrome c oxidase supercomplex . This relationship manifests in several important ways:

  • Structural Role: AIM31 contributes to the stability and organization of the supercomplex, ensuring optimal spatial arrangement of components for efficient electron transfer.

  • Functional Role: The protein facilitates electron transport between complex III (cytochrome bc1) and complex IV (cytochrome c oxidase), enhancing respiratory efficiency.

  • Regulatory Role: Evidence suggests that AIM31 may respond to environmental conditions (such as oxygen availability) to modulate respiratory chain activity.

  • Assembly Role: AIM31 participates in the proper assembly and maintenance of the supercomplex structure.

Deletion or mutation of AIM31 results in destabilization of the supercomplex, leading to decreased respiratory efficiency, increased reactive oxygen species production, and compromised mitochondrial function under certain conditions .

What experimental designs are most effective for studying AIM31 function in S. cerevisiae?

Effective experimental designs for studying AIM31 function should incorporate true experimental research principles with appropriate controls. The following approach is recommended:

True Experimental Design with Control Group:

  • Establish both experimental groups (with modified AIM31) and control groups (wild-type or empty vector)

  • Randomly assign samples to minimize bias

  • Systematically manipulate independent variables (e.g., AIM31 expression levels, growth conditions)

Variables to Consider:

  • Independent variables: AIM31 expression level, growth conditions (fermentable vs. non-fermentable carbon sources), oxygen availability

  • Dependent variables: Growth rate, mitochondrial membrane potential, supercomplex stability, respiratory capacity

  • Control variables: Temperature, media composition, cell density

Factorial Experimental Design:
A factorial design allows for testing multiple variables simultaneously and identifying interactions. For example:

Factor A: AIM31 ExpressionFactor B: Carbon SourceFactor C: Oxygen Level
Wild-typeGlucoseAerobic
OverexpressionGlycerolHypoxic
DeletionEthanolAnaerobic
Point mutationLactate-

This design enables researchers to assess the effects of each factor independently as well as their interactions, providing a comprehensive understanding of AIM31 function under various conditions .

Time-Course Experiments:
Given AIM31's role in mitochondrial inheritance, time-course experiments are particularly valuable. These should include:

  • Synchronization of yeast cultures

  • Collection of samples at defined time points

  • Monitoring of mitochondrial parameters throughout the cell cycle

How does the CRISPR/Cas9 system enhance the creation of recombinant S. cerevisiae strains expressing modified AIM31?

The CRISPR/Cas9 system offers several advantages for creating recombinant S. cerevisiae strains with modified AIM31:

High Efficiency Gene Editing:
The CRISPR/Cas9 system in S. cerevisiae can achieve nearly 100% efficiency when optimized properly . This high efficiency is partially due to the yeast's efficient homologous recombination machinery that repairs Cas9-induced double-strand breaks.

Multiplex Editing Capabilities:
Advanced CRISPR techniques enable simultaneous modification of multiple genetic loci. For example, the multiplex CRISPR approach developed by Ryan et al. utilizes a self-cleaving hepatitis delta virus ribozyme fused to sgRNA for the removal of redundant RNA sequences, achieving nearly 100% efficiency with a single sgRNA .

Precise Modification:
The system allows for precise edits at the nucleotide level:

  • Point Mutations: Introduction of specific amino acid changes to study structure-function relationships

  • Domain Swaps: Replacement of functional domains to analyze their contributions

  • Epitope Tagging: Addition of detection tags without disrupting protein function

Optimization Strategies:
To maximize CRISPR/Cas9 efficiency for AIM31 modification:

  • Utilize computer-aided design tools for optimal gRNA selection

  • Consider the PAM sequence requirements for the specific Cas variant used

  • Design appropriate donor DNA with sufficient homology arms

  • Implement advanced techniques like the programmable red light switch PhiReX 2.0, which has been shown to enable 6-fold upregulation of native promoters through sgRNA targeting

What are the challenges in interpreting phenotypic data from AIM31 mutant strains?

Interpreting phenotypic data from AIM31 mutant strains presents several significant challenges:

Pleiotropic Effects:
AIM31 mutations can affect multiple cellular processes beyond mitochondrial function, including:

  • General cellular stress responses

  • Metabolic adaptations

  • Nuclear gene expression changes

  • Cell cycle alterations

These pleiotropic effects complicate the attribution of observed phenotypes directly to AIM31 function.

Data Interpretation Guidelines:
When analyzing phenotypic data from AIM31 mutant strains, researchers should follow these principles:

  • Context-Specific Analysis: Interpret findings in the context of specific experimental conditions4

  • Avoid Redundancy: Prevent repetition of tabular data in textual descriptions4

  • Comparative Analysis: Identify both the highest and lowest values in datasets to establish ranges4

  • Literature Integration: Interpret results in the context of related literature and studies4

Methodological Approaches to Address Challenges:

  • Multi-parameter Analysis: Combine multiple assays to build a comprehensive phenotypic profile

  • Genetic Suppressor Screens: Identify genes that can rescue AIM31 mutant phenotypes

  • Synthetic Genetic Arrays: Map genetic interactions to place AIM31 in functional networks

  • Temporal Resolution: Analyze phenotypes at different time points to distinguish primary from secondary effects

Data Presentation Considerations:
When presenting complex phenotypic data, consider structured approaches:

Phenotypic ParameterWild-TypeAIM31 DeletionAIM31 OverexpressionStatistical Significance
Growth Rate (Glucose)+++++++++++++p < 0.05
Growth Rate (Glycerol)++++++++p < 0.01
Mitochondrial Membrane Potential100%65%110%p < 0.01
ROS Production+++++p < 0.01
Supercomplex StabilityStableUnstableEnhancedp < 0.001

How do alterations in AIM31 expression impact the mitochondrial cytochrome bc1-cytochrome c oxidase supercomplex?

Alterations in AIM31 expression have profound effects on the mitochondrial cytochrome bc1-cytochrome c oxidase supercomplex, which are observed at structural, functional, and regulatory levels:

Structural Impacts:
AIM31 (Rcf1) is a critical structural component of the supercomplex. Research has demonstrated that:

  • Deletion Effects: Deletion of AIM31 leads to destabilization of the supercomplex structure, resulting in dissociation of complex IV from the supercomplex .

  • Overexpression Effects: Overexpression can increase supercomplex formation and stability, potentially enhancing respiratory capacity under certain conditions.

  • Domain-Specific Functions: Different domains of AIM31 contribute differently to supercomplex stability, with the transmembrane domains being particularly important for integration into the complex.

Functional Consequences:
The structural changes induced by altered AIM31 expression translate into functional consequences:

  • Electron Transfer Efficiency: Disruption of AIM31 reduces the efficiency of electron transfer between complex III and complex IV.

  • Respiratory Capacity: Cells with deleted or mutated AIM31 show decreased oxygen consumption rates and reduced ATP production through oxidative phosphorylation.

  • Substrate Utilization: The ability to utilize non-fermentable carbon sources (which require functional respiration) is compromised in AIM31 mutants.

Regulatory Implications:
AIM31 appears to have regulatory roles beyond structural support:

  • Oxygen Sensing: Evidence suggests AIM31 may participate in adaptive responses to varying oxygen levels, potentially through its membership in the Hypoxia-induced Gene 1 Protein Family .

  • Supercomplex Composition: AIM31 may influence the stoichiometry of components within the supercomplex, optimizing its function for different metabolic states.

  • Reactive Oxygen Species Management: Proper AIM31 function contributes to minimizing ROS production by maintaining optimal electron flow through the respiratory chain.

What methods are most effective for analyzing mitochondrial inheritance patterns in AIM31 mutant strains?

Analyzing mitochondrial inheritance patterns in AIM31 mutant strains requires sophisticated methodological approaches:

Fluorescence Microscopy Techniques:

  • Mitochondrial Matrix Labeling: Use of matrix-targeted fluorescent proteins (mtGFP, mtRFP) to visualize entire mitochondrial networks.

  • Nucleoid Visualization: Employing DNA-binding dyes or fluorescently tagged nucleoid proteins to specifically track mitochondrial DNA.

  • Time-Lapse Imaging: Capturing the dynamic process of mitochondrial segregation during cell division in real-time.

  • Super-Resolution Microscopy: Techniques like STED or PALM to resolve fine details of mitochondrial structure beyond the diffraction limit.

Genetic Approaches:

  • Mitochondrial DNA Markers: Introduction of genetic markers in mtDNA to track inheritance patterns.

  • Heteroplasmy Analysis: Creating mixed populations of mitochondria with different genetic markers to quantify segregation patterns.

  • Mother-Daughter Cell Tracking: Micromanipulation techniques to separate mother and daughter cells for individual analysis.

Quantitative Analysis Methods:
Appropriate statistical methods are crucial for robust interpretation:

  • Bayesian Models: For analyzing inheritance probability distributions.

  • Markov Chain Models: For modeling the stochastic nature of mitochondrial inheritance.

  • Machine Learning Approaches: For pattern recognition in complex inheritance data.

Experimental Design Considerations:
For reliable results, experiments should include:

  • Synchronized Cultures: To ensure cells are at the same cell cycle stage.

  • Environmental Controls: Standardized growth conditions to minimize variability.

  • Multiple Timepoints: Sampling throughout several generations to capture inheritance dynamics.

  • Integration with Functional Data: Correlating inheritance patterns with respiratory function and fitness metrics.

Data Presentation Format:

ParameterWild-TypeAIM31 DeletionAIM31 Point Mutation
mtDNA Copy Number Variance (Mother:Daughter)1.2:13.5:11.8:1
Functional Respiratory Units InheritanceEqualBiased to motherModerately biased
Mitochondrial Membrane Potential InheritanceSymmetricAsymmetricPartially asymmetric
Nucleoid Distribution PatternEvenClusteredModerately clustered
Multi-Generation StabilityStableDeterioratingPartially stable

How can recombinant S. cerevisiae with modified AIM31 serve as a model for human mitochondrial diseases?

Recombinant S. cerevisiae strains with modified AIM31 provide valuable models for studying human mitochondrial diseases due to several factors:

Conserved Mitochondrial Machinery:
The fundamental components of mitochondrial respiration are conserved from yeast to humans. The human homolog of AIM31/Rcf1 belongs to the HIGD1 (Hypoxia-Inducible Gene Domain 1) family, with HIGD1A and HIGD2A performing similar functions in mammalian mitochondria . Mutations in these human homologs are associated with mitochondrial disorders.

Experimental Advantages:
S. cerevisiae offers significant advantages for modeling mitochondrial diseases:

  • Genetic Tractability: The ease of genetic manipulation in yeast allows for precise modeling of disease-associated mutations.

  • Facultative Anaerobe: S. cerevisiae can survive with dysfunctional mitochondria by utilizing fermentative metabolism, enabling the study of otherwise lethal mutations.

  • Rapid Generation Time: Quick life cycle facilitates studying inheritance patterns and long-term effects of mitochondrial dysfunction.

  • Well-Characterized Genome: Extensive knowledge of yeast genetics provides context for interpreting phenotypic changes.

Methodological Approach:
To effectively model human mitochondrial diseases:

  • Identify the human disease-associated mutation in HIGD family proteins

  • Create the equivalent mutation in yeast AIM31 using CRISPR/Cas9

  • Perform comprehensive phenotypic characterization

  • Validate findings in higher model systems when possible

What are the implications of AIM31 research for understanding evolutionary aspects of mitochondrial function?

Research on AIM31 provides significant insights into the evolutionary aspects of mitochondrial function:

Evolutionary Conservation:
AIM31/Rcf1 belongs to a protein family conserved across eukaryotes, from yeast to humans . This conservation suggests:

  • Fundamental Role: The protein likely performs a core function essential for mitochondrial operation in diverse organisms.

  • Adaptation Mechanisms: Variations in AIM31 homologs across species may reflect adaptations to different energetic demands.

  • Evolutionary Constraints: The structural requirements for supercomplex formation impose evolutionary constraints on sequence divergence.

Evolutionary Implications:
Studying AIM31 variants across species reveals:

  • Supercomplex Evolution: Insights into how respiratory chain supercomplexes evolved as efficiency-enhancing structures.

  • Mitochondrial-Nuclear Coevolution: Understanding how mitochondrial and nuclear genomes coevolved to maintain functional respiration.

  • Environmental Adaptation: How variations in AIM31 homologs may contribute to adaptation to different environments (e.g., oxygen availability, temperature ranges).

Methodological Approach for Evolutionary Studies:
Research approaches should include:

  • Comparative genomics of AIM31 homologs across diverse species

  • Functional complementation studies with homologs from different organisms

  • Reconstruction of ancestral AIM31 sequences to test evolutionary hypotheses

  • Analysis of selection pressures on different domains of the protein

What quality control measures are essential when working with recombinant S. cerevisiae expressing modified AIM31?

Implementing rigorous quality control measures is crucial when working with recombinant S. cerevisiae expressing modified AIM31:

Genetic Quality Control:

  • Sequence Verification: Confirm the exact sequence of the modified AIM31 gene through DNA sequencing.

  • Copy Number Analysis: Verify the copy number of integrated constructs using qPCR.

  • Genomic Stability Assessment: Ensure the modification remains stable over multiple generations.

  • Absence of Off-Target Effects: Verify that the CRISPR/Cas9 editing did not introduce unintended mutations elsewhere in the genome .

Expression Quality Control:

  • Protein Level Verification: Confirm appropriate expression levels through western blotting.

  • Subcellular Localization: Verify correct mitochondrial localization using fractionation or microscopy.

  • Post-Translational Modifications: Assess whether the modified AIM31 undergoes proper post-translational processing.

  • Protein Folding and Stability: Evaluate the structural integrity of the modified protein.

Functional Quality Control:

  • Respiratory Growth Assays: Test growth on non-fermentable carbon sources requiring mitochondrial function.

  • Oxygen Consumption Measurements: Quantify respiratory capacity using respirometry.

  • Supercomplex Assembly: Verify incorporation into the cytochrome bc1-cytochrome c oxidase supercomplex using blue native PAGE .

  • Mitochondrial Membrane Potential: Assess using fluorescent dyes like JC-1 or TMRM.

Experimental Controls:
Always include appropriate controls:

  • Wild-type strain (positive control)

  • AIM31 deletion strain (negative control)

  • Strain expressing unmodified AIM31 from the same genetic context

  • Empty vector control for plasmid-based expressions

How can researchers optimize CRISPR/Cas9 protocols specifically for AIM31 modifications in S. cerevisiae?

Optimizing CRISPR/Cas9 protocols for AIM31 modifications requires attention to several key factors:

sgRNA Design Optimization:

  • Target Site Selection: Select target sites within AIM31 with high specificity and minimal off-target potential.

  • PAM Availability: Ensure appropriate PAM sequences are available at desired modification sites .

  • sgRNA Efficiency Prediction: Utilize computational tools to predict sgRNA efficiency and specificity .

  • Secondary Structure Consideration: Design sgRNAs with minimal self-complementarity to avoid secondary structures that reduce efficiency.

Delivery System Optimization:

  • Vector Selection: Choose appropriate vectors for expression of Cas9 and sgRNA in S. cerevisiae.

  • Expression Level Control: Use promoters of appropriate strength to optimize Cas9 and sgRNA expression.

  • Timing of Expression: Consider inducible systems for temporal control of Cas9 expression.

  • Transformation Protocol: Optimize transformation conditions for maximum efficiency.

Repair Template Design:

  • Homology Arm Length: Include homology arms of 40-60 bp for efficient homologous recombination .

  • Silent Mutations in PAM: Introduce silent mutations in the PAM sequence to prevent re-cutting after successful editing.

  • Selection Markers: Include appropriate selection markers if needed for screening.

  • Structural Considerations: Ensure modifications don't disrupt critical protein domains or targeting signals.

Advanced Techniques:

  • Multiplex CRISPR: For complex modifications, implement multiplex CRISPR systems like that developed by Ryan et al., which utilizes self-cleaving ribozymes to achieve nearly 100% efficiency .

  • Prime Editing: Consider prime editing approaches for precise modifications without double-strand breaks.

  • Base Editing: For point mutations, base editing can provide high precision with reduced off-target effects.

  • Programmable Switches: Explore systems like PhiReX 2.0, which enables controlled 6-fold upregulation of native promoters through sgRNA targeting .

What are the future research directions for studying AIM31 in recombinant S. cerevisiae systems?

Future research on AIM31 in recombinant S. cerevisiae systems is likely to advance in several promising directions:

Structural Biology Approaches:
As techniques for membrane protein structure determination improve, direct structural analysis of AIM31 within the supercomplex will provide precise insights into its interactions and functional mechanisms. Cryo-electron microscopy and integrative structural biology approaches combining various techniques will be particularly valuable.

Systems Biology Integration:
Future research will likely place AIM31 function in broader cellular contexts through:

  • Multi-omics approaches (proteomics, metabolomics, transcriptomics)

  • Network analysis to understand how AIM31 perturbations propagate through cellular systems

  • Mathematical modeling of mitochondrial inheritance and supercomplex assembly dynamics

Biotechnological Applications:
The knowledge gained from AIM31 research may be applied to:

  • Engineering yeast strains with enhanced respiratory efficiency for biotechnological applications

  • Developing yeast-based screening systems for therapies targeting mitochondrial disorders

  • Creating biosensors for mitochondrial function using AIM31-based reporters

Therapeutic Relevance:
Research on AIM31 homologs in human cells (HIGD family proteins) may lead to:

  • Novel therapeutic targets for mitochondrial disorders

  • Insights into mitochondrial dysfunction in neurodegenerative diseases

  • Strategies for enhancing mitochondrial function in aging-related conditions

The future of AIM31 research promises to bridge fundamental cell biology with applications in biotechnology, medicine, and evolutionary biology, highlighting the continued importance of S. cerevisiae as a model organism for understanding conserved cellular processes.

How has our understanding of AIM31 function evolved over time, and what key questions remain unanswered?

Our understanding of AIM31 (Rcf1) has evolved significantly since its initial identification:

Historical Evolution of Understanding:

  • Initial Discovery Phase: AIM31 was first identified in a genetic screen for proteins affecting mitochondrial DNA inheritance, hence the name "Altered Inheritance of Mitochondria" .

  • Functional Characterization Phase: Subsequent research reclassified it as Rcf1 (Respiratory superComplex Factor 1) when its role in supercomplex formation was established .

  • Molecular Mechanism Phase: Recent work has begun to elucidate the precise molecular mechanisms by which AIM31/Rcf1 contributes to supercomplex stability and function.

  • Evolutionary Context Phase: Comparative studies have placed AIM31 in an evolutionary context by identifying and characterizing homologs across species.

Key Unanswered Questions:

  • Structural Mechanisms:

    • What is the exact structural arrangement of AIM31 within the supercomplex?

    • Which domains interact with which components of complex III and IV?

    • How do post-translational modifications affect these interactions?

  • Regulatory Functions:

    • Does AIM31 have regulatory functions beyond structural support?

    • How does it respond to changing metabolic conditions?

    • What signaling pathways regulate AIM31 expression and function?

  • Disease Relevance:

    • What is the full spectrum of human diseases associated with dysfunction of AIM31 homologs?

    • Can modulation of AIM31 homologs provide therapeutic benefits in mitochondrial disorders?

  • Evolutionary Aspects:

    • Why has this protein been conserved throughout eukaryotic evolution?

    • How have its functions diversified in different organisms?

    • What can AIM31 tell us about the evolution of the mitochondrial respiratory chain?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.