Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
INA17; AIM43; FMP14; SCY_5628; Inner membrane assembly complex subunit 17; Altered inheritance of mitochondria protein 43; Found in mitochondrial proteome protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-182
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
INA17
Target Protein Sequence
IKSLEDLANLDSLDGVDTELIRDLINEHTTKLNIKKELDMLKKFSQEEESGHEIPVKRFI RPLWMFILMGSSVYLLLHFSWWKLEHEERESQLKKEVEILEHQLNELIIQDKTHNTSRGK GSNESTHMKPWYRRWFW
Uniprot No.

Target Background

Function

AIM43 is a component of the mitochondrial INAC (INA complex) that plays a crucial role in the biogenesis of the F1F0-ATP synthase. Specifically, INAC facilitates the assembly of the peripheral stalk and promotes the integration of the catalytic F1-domain with the membrane-embedded F0-domain.

Protein Families
INA17 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is AIM43 and how is it related to mitochondrial inheritance in S. cerevisiae?

AIM43 (YPL099C) is a protein of unknown function in Saccharomyces cerevisiae that has been associated with mitochondrial inheritance. According to database information, it localizes to the mitochondrion and its precise molecular function remains uncharacterized . Mitochondrial inheritance in S. cerevisiae involves the transfer of mitochondria from mother to daughter cells during budding, a process that normally begins immediately after bud emergence . The inheritance process depends on replication and partitioning of mitochondrial DNA, cytoskeleton-dependent mitochondrial transport, intracellular positioning of the organelle, and coordination of these processes .

While the specific role of AIM43 hasn't been fully elucidated, it likely functions in pathways similar to other proteins that influence the timing of mitochondrial inheritance. For example, PTC1, a serine/threonine phosphatase, has been shown to affect the timing of mitochondrial inheritance, where cells lacking PTC1 initially produce buds without mitochondria, but eventually receive part of the mitochondrial network . Similar mechanisms may exist for AIM43.

What experimental methods are most effective for detecting AIM43 expression in recombinant S. cerevisiae?

For detecting AIM43 expression in recombinant S. cerevisiae, several complementary approaches are recommended:

  • Protein tagging and immunodetection: Express AIM43 fused with detectable tags such as FLAG, HA, or GFP, which can be visualized using Western blotting or fluorescence microscopy. This allows for protein localization and expression level analysis.

  • Galactose-inducible expression system: Utilize the Gal1/10 promoter-based system for controlled expression of recombinant AIM43. The protocol typically involves:

    • Subcloning the target DNA fragment into a yeast expression vector

    • Transforming the construct into protease-deficient yeast strains (e.g., YMY1032)

    • Inducing expression with galactose

    • Harvesting cells at OD600 of approximately 0.8

  • RT-qPCR: For mRNA level detection, real-time quantitative PCR can be used to measure transcript levels of AIM43 under different conditions.

How does the inheritance pattern of mitochondria in S. cerevisiae differ from other eukaryotic cells?

S. cerevisiae exhibits unique characteristics in mitochondrial inheritance compared to other eukaryotes:

FeatureS. cerevisiaeOther eukaryotes
Inheritance timingBegins immediately after bud emergenceVaries with cell division type
Transport mechanismActive transport via actin cytoskeletonOften microtubule-dependent
Inheritance controlGenetically regulated, with specific timingVarious mechanisms depending on organism
mtDNA organizationTypically larger, more variable genome sizeGenerally more compact
Role of cell divisionAsymmetric division with active inheritanceOften symmetric distribution

In S. cerevisiae, mitochondrial inheritance is an active, genetically controlled process rather than passive diffusion. Studies show that mitochondrial transport begins immediately after bud emergence in wild-type cells, suggesting tight coordination with the cell cycle . The process relies on the actin cytoskeleton rather than microtubules, as disruption of microtubules does not significantly impair polarized growth . Additionally, inheritance is not strictly dependent on attachment to the incipient bud site, as evidenced by the ability of mitochondria to move into large buds well after they have already formed .

What are the optimal conditions for expressing recombinant AIM43 in S. cerevisiae?

For optimal expression of recombinant AIM43 in S. cerevisiae, follow these methodological guidelines:

  • Vector selection and design:

    • Use a pYeastPro vector system with Gal1/10 promoter for inducible expression

    • Include appropriate purification tags (His, FLAG, etc.) depending on downstream applications

    • Ensure proper codon optimization for S. cerevisiae

  • Strain selection:

    • Utilize protease-deficient strains like YMY1032 to minimize protein degradation

    • Consider strains with reduced stress response for higher yield

  • Culture conditions:

    • Initial growth in glucose medium to OD600 of 0.8

    • Protein induction in galactose-containing medium

    • Maintain culture at 30°C with shaking at 220 rpm

    • Harvest cells after 6-8 hours of induction for optimal yield

  • Purification strategy:

    • Cell lysis using liquid nitrogen grinding (>99% efficiency)

    • Immobilized metal affinity chromatography for His-tagged proteins

    • Size exclusion chromatography for further purification if needed

How can researchers design experiments to study the effects of environmental factors on AIM43-related mitochondrial inheritance?

To study how environmental factors influence AIM43-related mitochondrial inheritance, implement the following experimental design approach:

  • Parallel experimental design:

    • Split samples into two experiments: one with controlled AIM43 expression and another with manipulated mediator conditions

    • This design improves identification power by providing additional information compared to single-experiment designs

  • Environmental factor testing:

    • Test various growth media compositions, temperature conditions, and stress factors

    • Include controls for each environmental condition

    • Use a systematic approach to test factors individually and in combination

  • Visualization and quantification:

    • Use fluorescent dyes like DiOC6 to stain mitochondrial networks

    • Quantify the percentage of buds with or without mitochondrial staining

    • Compare inheritance patterns across different conditions

  • Fitness competition assays:

    • Conduct competition assays between strains with different mitochondrial types

    • Assess relative fitness under various environmental conditions

    • Correlate fitness differences with inheritance patterns

As demonstrated in previous studies with environmental factors affecting mitochondrial inheritance in Saccharomyces yeast hybrids, such experiments can reveal that "environmental factors can influence mtDNA transmission in hybrid diploids, and that the inheritance patterns are strain dependent" .

What imaging techniques are most effective for tracking mitochondrial inheritance in S. cerevisiae with altered AIM43 expression?

For tracking mitochondrial inheritance in S. cerevisiae with modified AIM43 expression, the following imaging techniques are recommended:

  • Fluorescent mitochondrial dyes:

    • DiOC6 (3,3'-dihexyloxacarbocyanine iodide) - a potential-dependent fluorescent dye that stains mitochondrial networks

    • MitoTracker dyes - cell-permeant probes that localize to mitochondria and retain their fluorescence during fixation

  • Fluorescent protein tagging:

    • Express mitochondrial-targeted fluorescent proteins (mt-GFP, mt-RFP)

    • Tag AIM43 with a different color fluorescent protein to track co-localization

    • Use photoactivatable fluorescent proteins for pulse-chase experiments

  • Time-lapse confocal microscopy:

    • Perform live-cell imaging to track mitochondrial movement during cell division

    • Use temperature-controlled microscope chambers to maintain optimal growth conditions

    • Capture images at regular intervals (2-5 minutes) to document the inheritance process

  • Quantitative image analysis:

    • Measure the percentage of buds with mitochondrial staining at different cell cycle stages

    • Compare inheritance timing between wild-type and AIM43-modified strains

    • Use automated image analysis software to process large datasets

The effectiveness of these techniques has been demonstrated in previous studies of mitochondrial inheritance, where they revealed that in wild-type yeast, "mitochondrial inheritance occurs early in the cell cycle concomitant with bud emergence" , while in mutants with altered inheritance, buds may initially lack mitochondria but receive them later.

How should researchers approach contradictory data when studying AIM43's role in mitochondrial inheritance?

When encountering contradictory data regarding AIM43's role in mitochondrial inheritance, follow this methodological framework:

  • Thorough examination of data:

    • Identify discrepancies in the dataset by comparing expected results with actual findings

    • Pay close attention to outliers that may significantly influence results

    • Compare data with existing literature on mitochondrial inheritance

  • Evaluate initial assumptions and research design:

    • Review experimental controls and protocols for potential issues

    • Consider whether strain background differences might explain contradictory results

    • Assess whether environmental conditions were consistently maintained

  • Consider alternative explanations:

    • Evaluate whether AIM43 might function in multiple pathways

    • Determine if compensatory mechanisms are activated in AIM43-deficient strains

    • Consider potential interactions with other proteins involved in mitochondrial inheritance

  • Implement additional controls:

    • Include epistasis experiments with mutations in related pathways

    • Test whether AIM43 effects are dependent on specific conditions

    • Design experiments to distinguish between direct and indirect effects

  • Refine the hypothesis:

    • Modify your hypothesis based on the contradictory findings

    • Design targeted experiments to test the refined hypothesis

    • Consider that contradictions may reveal new biological insights

For example, in studies of PTC1's role in mitochondrial inheritance, researchers discovered through epistasis experiments that "PTC1 is not acting through the HOG pathway to control the timing of mitochondrial inheritance" despite previous assumptions, leading to a refined understanding of the mechanisms involved .

What statistical approaches are appropriate for analyzing the effects of AIM43 modification on mitochondrial inheritance patterns?

To analyze the effects of AIM43 modification on mitochondrial inheritance patterns, implement these statistical approaches:

  • Descriptive statistics and visualization:

    • Calculate percentages of buds with and without mitochondrial staining

    • Compare inheritance timing between wild-type and modified strains

    • Use box plots, histograms, and scatter plots to visualize distributions

  • Hypothesis testing:

    • Use chi-square tests to compare proportions of buds with mitochondria across strains

    • Apply t-tests or ANOVA to compare continuous variables between experimental groups

    • Implement non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normally distributed data

  • Regression analysis:

    • Use logistic regression to identify factors influencing the probability of mitochondrial inheritance

    • Apply multiple regression to model relationships between variables

    • Include interaction terms to identify combined effects of factors

  • Experimental design optimization:

    • Consider UC-optimality criterion to minimize prediction variance

    • Evaluate trade-offs between experimental design, sample size, and censoring

    • Assess sensitivity of experimental designs to parameter estimates

  • Model validation:

    • Perform cross-validation to assess model performance

    • Use bootstrapping to establish confidence intervals

    • Compare multiple models to identify the most robust approach

In previous studies of mitochondrial inheritance, researchers typically reported the percentage of buds lacking mitochondrial staining under different conditions, allowing for quantitative comparisons between strains. For example, in PTC1 studies, 29.6% of buds in ptc1Δ mutants lacked mitochondrial staining compared to only 4.7% in wild-type strains .

How can researchers distinguish between direct effects of AIM43 on mitochondrial inheritance versus indirect effects through other cellular pathways?

To differentiate between direct and indirect effects of AIM43 on mitochondrial inheritance, employ these methodological approaches:

  • Epistasis analysis:

    • Create double mutants combining AIM43 disruption with mutations in known mitochondrial inheritance pathways

    • Compare phenotypes of single and double mutants to identify genetic interactions

    • Interpret patterns to determine pathway relationships

  • Domain mapping and protein interaction studies:

    • Create truncated or point-mutated versions of AIM43 to identify functional domains

    • Perform co-immunoprecipitation experiments to identify binding partners

    • Use yeast two-hybrid screening to detect protein-protein interactions

  • Temporal analysis of phenotypes:

    • Use time-course experiments to determine the sequence of events following AIM43 manipulation

    • Apply conditional expression systems to induce AIM43 at specific cell cycle stages

    • Compare the timing of effects with known cellular processes

  • Pathway-specific interventions:

    • Selectively inhibit or activate specific cellular pathways in AIM43-modified strains

    • Examine whether these interventions restore or exacerbate the inheritance phenotype

    • Use chemical genetics approaches with pathway-specific inhibitors

  • Subcellular localization studies:

    • Conduct detailed co-localization studies to determine precisely where AIM43 functions

    • Use fractionation techniques to isolate specific cellular compartments

    • Examine the timing of AIM43 localization changes relative to inheritance events

This approach was effectively demonstrated in studies of PTC1's role in mitochondrial inheritance, where researchers determined that "PTC1 is not acting through the HOG pathway to influence the mitochondrial transport machinery in the cell" by creating double mutants (ptc1Δ hog1Δ and ptc1Δ pbs2Δ) and showing that "the ptc1Δ hog1Δ double mutant did not exhibit a less pronounced mitochondrial inheritance defect than that observed in the ptc1Δ single mutant" .

How might proteome-constrained modeling be applied to understand AIM43's role in mitochondrial inheritance and protein secretion?

Proteome-constrained modeling offers a sophisticated approach to understand AIM43's functional role:

  • Implementing proteome-constrained genome-scale models:

    • Adapt the proteome-constrained genome-scale protein secretory model of yeast (pcSecYeast) to include mitochondrial inheritance factors

    • Integrate AIM43 into the model based on known interaction data and localization

    • Simulate phenotypes caused by limited secretory capacity or altered mitochondrial inheritance

  • Predicting functional impacts:

    • Use the model to simulate cellular responses to AIM43 overexpression or deletion

    • Predict potential overexpression targets that might interact with AIM43

    • Identify compensatory mechanisms that might activate when AIM43 function is compromised

  • Model validation through targeted experiments:

    • Experimentally validate predicted targets using genetic modifications

    • Test model predictions regarding AIM43's role in different cellular contexts

    • Refine the model based on experimental outcomes

  • Analyzing system-level effects:

    • Predict how AIM43 modifications might affect global cellular processes

    • Model the interplay between mitochondrial inheritance and protein secretion pathways

    • Identify potential metabolic bottlenecks caused by AIM43 dysfunction

The pcSecYeast approach has been successfully applied to "simulate and explain phenotypes caused by limited secretory capacity" and "predict overexpression targets for the production of several recombinant proteins" , suggesting its potential utility for understanding AIM43's role in coordinating mitochondrial inheritance with other cellular processes.

What approaches can be used to study the relationship between AIM43, mitochondrial inheritance, and cell cycle regulation?

To investigate connections between AIM43, mitochondrial inheritance, and the cell cycle, implement these advanced approaches:

  • Cell cycle synchronization techniques:

    • Use alpha-factor arrest and release to synchronize cells

    • Implement hydroxyurea block to study S-phase effects

    • Employ nocodazole treatment to examine M-phase processes

  • Live-cell imaging with cell cycle markers:

    • Combine mitochondrial tracking with cell cycle phase reporters

    • Use fluorescent markers for bud emergence, DNA replication, and nuclear division

    • Perform time-lapse microscopy to correlate mitochondrial movements with cell cycle progression

  • Conditional expression systems:

    • Create strains with AIM43 under control of cell cycle-specific promoters

    • Use degron-tagged AIM43 for rapid protein depletion at specific cell cycle phases

    • Employ optogenetic tools to manipulate AIM43 activity with temporal precision

  • Genetic interaction mapping:

    • Screen for genetic interactions between AIM43 and cell cycle regulators

    • Create double mutants combining AIM43 disruption with mutations in cyclins, CDKs, or checkpoint proteins

    • Use synthetic genetic array (SGA) analysis to identify functional relationships

  • Phosphorylation state analysis:

    • Examine whether AIM43 undergoes cell cycle-dependent phosphorylation

    • Identify kinases and phosphatases that might regulate AIM43

    • Create phospho-mimetic or phospho-resistant AIM43 variants to test functional impacts

Previous research on mitochondrial inheritance timing in S. cerevisiae has established that "mitochondrial inheritance occurs early in the cell cycle concomitant with bud emergence" , suggesting tight coordination with the cell cycle. Studies of PTC1, a serine/threonine phosphatase affecting mitochondrial inheritance timing, revealed that it may be "acting directly or through an alternative signaling pathway" rather than through the expected HOG pathway , highlighting the complexity of these regulatory networks.

How can CRISPR-Cas9 gene editing be optimized for studying AIM43 function in mitochondrial inheritance?

For optimizing CRISPR-Cas9 gene editing to study AIM43 function in mitochondrial inheritance, implement these methodological approaches:

  • Guide RNA design strategies:

    • Design multiple sgRNAs targeting different regions of the AIM43 gene

    • Use yeast-optimized sgRNA design algorithms to maximize efficiency

    • Include control sgRNAs targeting non-essential genes to validate the system

  • Editing strategies beyond knockouts:

    • Create precise point mutations to target specific domains

    • Implement base editing for specific nucleotide changes without double-strand breaks

    • Use prime editing for more complex sequence modifications

    • Design knock-in strategies to add tags or reporters to the endogenous AIM43 locus

  • Delivery optimization:

    • Express Cas9 and sgRNA from different promoters (constitutive vs. inducible)

    • Optimize transformation protocols specifically for CRISPR components

    • Consider using RNP (ribonucleoprotein) delivery for transient editing

  • Multiplex editing approaches:

    • Target AIM43 simultaneously with other genes in mitochondrial inheritance pathways

    • Create combinatorial mutations to study genetic interactions

    • Implement arrayed CRISPR screens to systematically evaluate genetic relationships

  • Repair template design:

    • Include extended homology arms (500-1000bp) for efficient homology-directed repair

    • Design templates with silent mutations in the PAM site to prevent re-cutting

    • Incorporate selectable markers that can later be removed using site-specific recombination

  • Phenotypic validation:

    • Combine genetic modifications with the mitochondrial visualization techniques

    • Quantify inheritance patterns using standardized imaging protocols

    • Compare edited strains with traditional knockout methods to validate results

This approach allows for precise genetic manipulation to determine AIM43's specific role in mitochondrial inheritance, including creation of specific mutations that might affect only certain aspects of AIM43 function rather than eliminating the protein entirely.

What are the most promising approaches for exploring the evolutionary conservation of AIM43 function across yeast species?

To investigate evolutionary conservation of AIM43 function across yeast species, implement these approaches:

  • Comparative genomics analysis:

    • Identify AIM43 homologs across diverse yeast species using BLAST, OrthoMCL, and HomoloGene databases

    • Compare sequence conservation, domain architecture, and predicted structures

    • Analyze synteny patterns to understand genomic context conservation

  • Cross-species complementation studies:

    • Express AIM43 homologs from different yeast species in S. cerevisiae AIM43 deletion strains

    • Assess rescue of mitochondrial inheritance phenotypes

    • Identify functionally conserved regions through chimeric protein expression

  • Phylogenetic analysis with functional correlation:

    • Construct phylogenetic trees of AIM43 homologs

    • Map known functional data onto the phylogeny

    • Identify correlation between sequence divergence and functional differences

  • Hybrid species studies:

    • Create hybrid strains between closely related Saccharomyces species

    • Examine mitochondrial inheritance patterns in hybrids under various environmental conditions

    • Assess the influence of AIM43 variants on inheritance patterns

  • Evolutionary rate analysis:

    • Calculate evolutionary rates (dN/dS) across AIM43 sequences

    • Identify regions under purifying or positive selection

    • Correlate evolutionary constraints with functional domains

According to OrthoMCL database information, AIM43 homologs exist in multiple yeast species including Ashbya gossypii, Candida glabrata, Debaryomyces hansenii, and Kluyveromyces lactis , providing diverse candidates for comparative analysis. Studies on mitochondrial inheritance in Saccharomyces hybrids have shown that "environmental factors can influence mtDNA transmission in hybrid diploids, and that the inheritance patterns are strain dependent" , suggesting species-specific functions that merit further investigation.

How can whole recombinant S. cerevisiae yeast expressing AIM43 variants be used as potential research tools or therapeutic applications?

Whole recombinant S. cerevisiae expressing AIM43 variants offers several advanced research and potential therapeutic applications:

  • Immunological research applications:

    • Develop whole, heat-killed recombinant S. cerevisiae expressing AIM43 variants to study immune responses

    • Investigate interactions between yeast-expressed AIM43 and dendritic cells

    • Examine T-cell activation patterns in response to different AIM43 variants

  • Mitochondrial disease modeling:

    • Create yeast strains expressing human disease-associated variants of AIM43 homologs

    • Use these strains to screen for therapeutic compounds

    • Develop high-throughput assays based on mitochondrial inheritance phenotypes

  • Vaccine development platforms:

    • Utilize the strong adjuvant effect of yeast to develop potential mitochondrial disease vaccines

    • Leverage the ability of yeast to "exert a strong adjuvant effect, augmenting DC presentation of exogenous whole-protein antigen to MHC class I- and class II-restricted T cells"

    • Optimize antigen presentation through different AIM43 fusion constructs

  • Drug discovery applications:

    • Develop AIM43 variant libraries to screen for compounds affecting mitochondrial inheritance

    • Utilize whole-cell assays to identify molecules that modulate AIM43 function

    • Screen for suppressors of mitochondrial inheritance defects

  • Bioproduction optimization:

    • Engineer AIM43 variants that might improve mitochondrial function for enhanced bioproduction

    • Develop strains with optimized mitochondrial networks for increased metabolic efficiency

    • Create reporter systems based on AIM43 for monitoring mitochondrial health in bioproduction

Previous studies have demonstrated that "whole recombinant Saccharomyces cerevisiae yeast expressing tumor or HIV-1 antigens potently induced antigen-specific, CTL responses" , suggesting similar approaches could be applied with AIM43 variants. Furthermore, recombinant yeast has shown effectiveness in "activating dendritic cells and eliciting protective T-cell responses" , highlighting the potential for various applications beyond basic research.

What are the major challenges in studying the function of a protein like AIM43 with unknown function, and how can they be addressed?

Studying proteins of unknown function like AIM43 presents several challenges that can be addressed through methodical approaches:

  • Lack of functional annotation:

    • Challenge: AIM43 is described as a "protein of unknown function" , providing minimal starting information.

    • Solution: Implement systematic phenotypic screening, starting with mitochondrial morphology, inheritance patterns, and stress responses. Compare phenotypes with known mitochondrial inheritance mutants like ptc1Δ .

  • Potential functional redundancy:

    • Challenge: Functional redundancy may mask phenotypes in single gene deletions.

    • Solution: Create double or triple mutants with genes in related pathways. Implement synthetic genetic array (SGA) analysis to identify genetic interactions that reveal functional relationships.

  • Context-dependent function:

    • Challenge: AIM43 may only exhibit phenotypes under specific conditions.

    • Solution: Test function across diverse environmental conditions, similar to studies showing environmental influences on mitochondrial inheritance in yeast hybrids . Examine function during different growth phases and stress conditions.

  • Protein-protein interaction identification:

    • Challenge: Identifying interaction partners for functional characterization.

    • Solution: Implement affinity purification coupled with mass spectrometry (AP-MS), proximity labeling approaches (BioID, APEX), and yeast two-hybrid screening to map the AIM43 interaction network.

  • Subcellular localization precision:

    • Challenge: General mitochondrial localization provides limited functional insight.

    • Solution: Use super-resolution microscopy and submitochondrial fractionation to determine precise localization within mitochondrial compartments. Compare localization patterns with known mitochondrial inheritance factors.

How can researchers troubleshoot common issues in recombinant AIM43 expression and purification from S. cerevisiae?

For troubleshooting recombinant AIM43 expression and purification from S. cerevisiae, implement these methodological solutions:

  • Low expression levels:

    • Issue: Poor protein yield despite confirmed construct integrity.

    • Solution: Optimize codon usage for S. cerevisiae, select appropriate promoters (GAL1/10 for inducible or TDH3 for constitutive expression), and test different growth conditions. Consider using protease-deficient strains like YMY1032 .

  • Protein degradation during purification:

    • Issue: Significant protein loss during extraction and purification.

    • Solution: Include protease inhibitors during cell lysis, maintain samples at 4°C throughout processing, and optimize buffer conditions. Consider rapid purification techniques such as immobilized metal affinity chromatography followed by size exclusion chromatography .

  • Poor solubility:

    • Issue: AIM43 forms inclusion bodies or aggregates.

    • Solution: Test different solubility tags (MBP, SUMO, etc.), optimize buffer conditions with various detergents or stabilizing agents, and consider native purification conditions rather than denaturing methods.

  • Low purity:

    • Issue: Contaminants persist after initial purification steps.

    • Solution: Implement multiple purification steps, including ion exchange chromatography after initial affinity purification. Consider tandem affinity purification with dual tags for improved purity.

  • Loss of functional activity:

    • Issue: Purified protein lacks expected activity.

    • Solution: Verify protein folding using circular dichroism spectroscopy, test different buffer conditions to maintain activity, and consider co-expression with potential cofactors or binding partners.

As noted in protocols for recombinant protein purification from yeast, "cell grinding could be performed in the liquid nitrogen-based apparatus with a breaking efficiency of >99%" for effective extraction, and subsequent purification can utilize "simple immobilized metal affinity chromatography" , providing a foundation for optimizing AIM43-specific protocols.

What experimental controls are essential when studying the effects of AIM43 on mitochondrial inheritance patterns?

When investigating AIM43's effects on mitochondrial inheritance, implement these essential experimental controls:

  • Genetic controls:

    • Wild-type control: Include isogenic wild-type strains to establish baseline inheritance patterns

    • Known mitochondrial inheritance mutants: Include positive controls such as ptc1Δ strains with documented inheritance defects

    • Complementation control: Reintroduce wild-type AIM43 into deletion strains to confirm phenotype rescue

    • Empty vector control: For overexpression studies, include strains with the expression vector lacking AIM43

  • Mitochondrial visualization controls:

    • Dye specificity control: Verify mitochondrial staining specificity using established markers

    • Microscopy controls: Include calibration standards for quantitative imaging

    • Time point controls: Examine multiple time points to distinguish delayed inheritance from complete blocks

    • Cell viability control: Confirm that observed phenotypes aren't due to decreased cell viability

  • Environmental condition controls:

    • Growth phase control: Analyze cells at comparable growth phases

    • Temperature controls: Maintain consistent temperature during experiments

    • Media composition control: Standardize media to eliminate variability

    • Stress response control: Include controls for potential stress responses that might affect mitochondrial dynamics

  • Data analysis controls:

    • Blinded analysis: Perform quantification without knowledge of sample identity

    • Statistical controls: Include appropriate statistical tests and multiple biological replicates

    • Technical replicates: Perform multiple measurements for each biological sample

    • Randomization: Randomize sample processing order to minimize batch effects

In previous studies of mitochondrial inheritance, researchers typically reported inheritance defects as "percentage of buds lacking mitochondrial staining" with clear comparisons between mutant and wild-type strains, such as "29.6% of buds without mitochondrial staining in ptc1Δ compared to 4.7% in wild-type" .

How does research on AIM43 and mitochondrial inheritance connect with studies of yeast meiosis, recombination, and DNA repair?

Research on AIM43 and mitochondrial inheritance shares important connections with yeast meiosis, recombination, and DNA repair through these integrated pathways:

  • Shared molecular machinery:

    • Both mitochondrial inheritance and DNA recombination/repair depend on specialized protein complexes

    • Some proteins may serve dual functions in nuclear and mitochondrial processes

    • S. cerevisiae proteins like Rad52 are "required for both meiotic recombination and mitotic recombination"

  • Evolutionary significance:

    • Mitochondrial inheritance patterns and meiotic recombination both influence genetic diversity

    • In S. cerevisiae, "outcrossing occurs only about once every 50,000 cell divisions"

    • Mitochondrial inheritance in hybrids can be influenced by environmental factors, affecting evolutionary trajectories

  • Coordination during cell division:

    • Both processes must be precisely coordinated with the cell cycle

    • Mitochondrial inheritance begins "early in the cell cycle concomitant with bud emergence"

    • Meiotic events and mitochondrial segregation must be properly timed for successful reproduction

  • DNA maintenance systems:

    • Mitochondrial DNA and nuclear DNA both require maintenance mechanisms

    • Studies suggest "the main selective force maintaining meiosis is enhanced recombinational repair of DNA damage"

    • Understanding how AIM43 affects mtDNA stability could reveal parallels with nuclear DNA maintenance

  • Experimental approaches:

    • Similar genetic and cytological techniques can be applied to both areas

    • Fluorescent tagging and live-cell imaging are valuable for studying both processes

    • Mutant analysis reveals the functional significance of specific proteins in each pathway

The integrated study of these processes provides a more comprehensive understanding of cellular reproduction and maintenance strategies in eukaryotes.

How can understanding AIM43's role in mitochondrial inheritance inform broader studies of mitochondrial diseases in humans?

Understanding AIM43's role in mitochondrial inheritance in yeast can inform human mitochondrial disease research through these translational approaches:

  • Functional conservation analysis:

    • Identify human homologs of AIM43 through comparative genomics

    • Characterize whether these homologs participate in similar mitochondrial processes

    • Use yeast as a model to study conserved mechanisms of mitochondrial inheritance and distribution

  • Disease mechanism modeling:

    • Create yeast strains with AIM43 mutations that mimic human disease-associated variants

    • Evaluate effects on mitochondrial inheritance, morphology, and function

    • Use yeast as a high-throughput screening platform for potential therapeutic compounds

  • mtDNA inheritance insights:

    • Apply findings about AIM43's role in mtDNA inheritance to understand human maternal inheritance patterns

    • Investigate whether similar molecular mechanisms regulate mitochondrial distribution in human cells

    • Study how environmental factors affect mitochondrial inheritance in model systems, as they do in yeast hybrids

  • Therapeutic target identification:

    • Identify pathways regulated by AIM43 that might be targeted in mitochondrial diseases

    • Screen for compounds that modify AIM43 function or compensate for its loss

    • Develop yeast-based assays for drug discovery focusing on conserved mitochondrial processes

  • Cell division and inheritance connections:

    • Explore how findings about mitochondrial inheritance timing in yeast relate to stem cell division in humans

    • S. cerevisiae "divides asymmetrically by using a polarized cell to make two daughters with different fates and sizes. Similarly, stem cells use asymmetric division for self-renewal and differentiation"

    • Investigate whether mitochondrial inheritance influences cell fate decisions in human development

By understanding fundamental mechanisms of mitochondrial inheritance in yeast, researchers can develop new hypotheses about mitochondrial dysfunction in human diseases and design targeted experiments in higher model organisms.

What interdisciplinary approaches combining genetics, biochemistry, and computational modeling would be most effective for characterizing AIM43 function?

For comprehensive characterization of AIM43 function, implement these interdisciplinary approaches:

  • Integrated genetic analysis:

    • Perform systematic genetic interaction mapping through synthetic genetic array (SGA) analysis

    • Create conditional alleles (temperature-sensitive, auxin-inducible degrons) for temporal studies

    • Implement CRISPR screening to identify genetic modifiers of AIM43 phenotypes

    • Use transposon mutagenesis to map functional domains

  • Advanced biochemical characterization:

    • Conduct affinity purification coupled with mass spectrometry to identify interaction partners

    • Perform in vitro reconstitution of AIM43 with potential cofactors

    • Use structural biology techniques (X-ray crystallography, cryo-EM) to determine AIM43 structure

    • Employ proximity labeling (BioID, APEX) to map the AIM43 interactome in living cells

  • Computational modeling approaches:

    • Develop proteome-constrained models similar to pcSecYeast to simulate AIM43's role in cellular processes

    • Use structure prediction tools to model AIM43 structure and identify functional domains

    • Implement machine learning to predict functional connections based on multi-omics data

    • Create dynamic models of mitochondrial inheritance incorporating AIM43 function

  • Systems biology integration:

    • Conduct transcriptomic and proteomic profiling of AIM43 mutants under various conditions

    • Perform metabolomic analysis to identify metabolic changes associated with AIM43 dysfunction

    • Implement flux balance analysis to model metabolic impacts of altered mitochondrial inheritance

    • Develop predictive models of mitochondrial inheritance based on multiple parameters

  • Advanced imaging and biophysical techniques:

    • Use super-resolution microscopy to precisely localize AIM43 within mitochondria

    • Implement live-cell tracking of mitochondrial movement in wild-type and mutant cells

    • Apply single-molecule approaches to study AIM43 dynamics in real-time

    • Develop computational image analysis pipelines for quantitative phenotyping

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.