Recombinant Saccharomyces cerevisiae Altered inheritance rate of mitochondria protein 38 (AIM38)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCF2; AIM38; YNR018W; N3185; Respiratory supercomplex factor 2, mitochondrial; Altered inheritance of mitochondria protein 38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RCF2
Target Protein Sequence
MKILTQDEIEAHRSHTLKGGIEGALAGFAISAIIFKVLPRRYPKFKPSTLTWSIKTALWI TPPTVLTAICAEEASNNFDATMYGSGSSSEDALDEHRRWKSLSTKDKFVEGLSNNKYKII TGAWAASLYGSWVIVNKDPIMTKAQKIVQARMYAQFITVGLLLASVGLSMYENKLHPNKQ KVNEMRRWENALRVAEEEERLEKEGRRTGYVSNEERINSKIFKS
Uniprot No.

Target Background

Function
Recombinant *Saccharomyces cerevisiae* Altered Inheritance Rate of Mitochondria protein 38 (AIM38), also known as Rcf1, is an assembly factor crucial for the formation of respiratory chain supercomplexes (SCs). These SCs consist of ubiquinol-cytochrome c oxidoreductase (complex III, CIII) and cytochrome c oxidase (complex IV, CIV). Rcf1 is involved in the late-stage assembly of COX12 and COX13 subunits. Furthermore, it is essential for maintaining a normal proton motive force (PMF) across the inner mitochondrial membrane (IMM) by preventing proton leakage through inactive CIV, which accumulates in the absence of Rcf1 and/or Rcf2.
Gene References Into Functions
  1. Rcf1 exhibits functional overlap with Rcf2 (formerly Aim38). Their combined presence is necessary for optimal COX activity and the proper assembly of the cytochrome bc1-COX supercomplex. [PMID: 22310663]
Database Links

KEGG: sce:YNR018W

STRING: 4932.YNR018W

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM38 and what is its role in mitochondrial function?

AIM38, also known as RCF2 (Respiratory supercomplex factor 2), is a transmembrane protein in Saccharomyces cerevisiae that belongs to the hypoxia-induced gene 1 (Hig1) protein family. This protein was identified as a critical component of the mitochondrial cytochrome bc1-cytochrome c oxidase supercomplex . The full protein is 224 amino acids in length with the sequence: MKILTQDEIEAHRSHTLKGGIEGALAGFAISAIIFKVLPRRYPKFKPSTLTWSIKTALWITPPTVLTAICAEEASNNFDATMYGSGSSSEDALDEHRRWKSLSTKDKFVEGLSNNKYKIITGAWAASLYGSWVIVNKDPIMTKAQKIVQARMYAQFITVGLLLASVGLSMYENKLHPNKQKVNEMRRWENALRVAEEEERLEKEGRRTGYVSNEERINSKIFKS .

AIM38 functions primarily in the organization and stability of respiratory chain complexes. Research has demonstrated that it represents a critical factor in the maintenance of the cytochrome bc1-cytochrome c oxidase supercomplex, which is essential for efficient electron transfer in the respiratory chain . When studying this protein, researchers should consider its integral membrane nature and its interactions with other components of the respiratory chain.

How was AIM38 initially discovered and what was its original characterization?

AIM38 was initially discovered through a genetic screen designed to identify mutants with altered inheritance of mitochondrial DNA (mtDNA) . The original name "AIM" stands for "Altered Inheritance rate of Mitochondria," indicating its role in mitochondrial genetics and inheritance patterns. Later research reclassified it as Rcf2 (Respiratory supercomplex factor 2) based on its functional characterization .

The initial characterization involved screening for phenotypes related to mitochondrial function and inheritance. Researchers typically use methods such as gene knockout studies, complementation assays, and phenotypic analysis under different growth conditions to characterize proteins like AIM38. When conducting similar screens, it's essential to include appropriate controls and verify results through multiple methodological approaches, as mitochondrial phenotypes can be subtle and affected by growth conditions.

What experimental approaches are most effective for studying AIM38 expression and localization?

For studying AIM38 expression, quantitative PCR (qPCR) and Western blotting are standard techniques. To effectively study the expression patterns, researchers should:

  • Design primers specific to the AIM38 gene, avoiding cross-reactivity with similar sequences

  • Use appropriate housekeeping genes for normalization (e.g., ACT1 in yeast)

  • Compare expression under different growth conditions, particularly aerobic versus anaerobic conditions

For localization studies, researchers typically employ:

  • Fluorescent tagging with GFP or similar reporters, with careful consideration of tag placement to avoid disrupting protein function

  • Subcellular fractionation followed by Western blotting

  • Immunoelectron microscopy for high-resolution localization within mitochondrial subcompartments

When performing localization studies, it's critical to verify that any protein tags do not disrupt the transmembrane domains, as AIM38 is a transmembrane protein with specific orientation in the mitochondrial membrane . Additionally, proper mitochondrial isolation techniques are essential, utilizing differential centrifugation followed by density gradient purification to obtain clean mitochondrial fractions.

How does AIM38 contribute to the formation and stability of respiratory supercomplexes?

AIM38/Rcf2, along with Rcf1 (formerly Aim31), plays a crucial role in the formation and stability of mitochondrial respiratory supercomplexes. These proteins function as assembly factors that facilitate the interaction between cytochrome bc1 (Complex III) and cytochrome c oxidase (Complex IV) . The supercomplexes enhance electron transfer efficiency and may provide stability to the individual complexes.

Experimental evidence indicates that AIM38 physically interacts with components of Complex IV and potentially serves as a bridge to Complex III. When studying these interactions, researchers should employ techniques such as:

  • Blue Native PAGE (BN-PAGE) to visualize intact supercomplexes

  • Co-immunoprecipitation (Co-IP) to identify physical interactions

  • Crosslinking mass spectrometry to map precise interaction sites

A key methodological approach used in previous studies combined BN-PAGE with quantitative analysis using stable isotope labeling and LC-FT(ICR)-MS/MS to identify and quantify supercomplex components . This approach allowed researchers to detect changes in supercomplex composition under different conditions and identify novel interaction partners. For example, research has shown that "protein Aim38p, with a yet unknown function, was identified as a possible component of respiratory chain complex IV" .

How does AIM38 function differ under aerobic versus anaerobic conditions?

The function of AIM38 varies significantly between aerobic and anaerobic conditions, reflecting the adaptability of S. cerevisiae to different oxygen environments. Under anaerobic conditions, where the respiratory chain is not fully active, respiratory chain supercomplexes containing AIM38 are still present but at reduced levels .

Research has shown that the composition of these mitochondrial complexes remains largely unchanged under aerobic or anaerobic conditions, with the exception of Complex II . When designing experiments to study these differences, researchers should:

  • Maintain precise control over oxygen levels using specialized equipment such as anaerobic chambers or controlled fermenters

  • Use steady-state chemostat cultures to ensure consistent conditions

  • Employ comparative proteomics approaches to quantify changes in protein expression and complex formation

A particularly effective experimental design involves three parallel approaches as demonstrated in previous research: "Three lines of investigation of the response of the mitochondrial proteome to anaerobiosis were chosen," allowing for comprehensive analysis of the mitochondrial membrane protein complexes under different oxygen conditions .

What is the relationship between AIM38 and mitochondrial DNA inheritance?

As suggested by its original name (Altered Inheritance rate of Mitochondria protein 38), AIM38 plays a role in mitochondrial DNA inheritance. While the exact mechanism remains under investigation, several methodological approaches can help elucidate this connection:

  • Quantitative PCR to measure mtDNA copy number in wild-type versus AIM38 knockout strains

  • Fluorescence microscopy with mtDNA-specific dyes to visualize mtDNA nucleoids

  • Genetic crosses followed by analysis of mtDNA segregation patterns

When studying mitochondrial inheritance patterns, it's important to understand that in yeast, unlike humans where mtDNA is primarily maternally inherited, mitochondrial inheritance can be biparental . Additionally, heteroplasmy (the presence of multiple mtDNA variants within a single cell) can occur and complicate analysis .

Research designs should account for the dynamic nature of mitochondria, which undergo fusion and fission, potentially mixing mitochondrial contents including mtDNA. Time-lapse microscopy with fluorescently labeled mitochondria and mtDNA can provide insights into how AIM38 affects these dynamics and subsequent inheritance patterns.

What are the molecular mechanisms by which AIM38 affects respiratory supercomplex assembly?

The molecular mechanisms underlying AIM38's role in respiratory supercomplex assembly involve specific protein-protein interactions within the mitochondrial membrane. As a member of the hypoxia-induced gene 1 protein family, AIM38 likely responds to oxygen levels and influences the organization of respiratory complexes accordingly .

To investigate these molecular mechanisms, researchers should consider these methodological approaches:

  • Site-directed mutagenesis to identify critical residues for protein-protein interactions

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Cryo-electron microscopy of isolated supercomplexes to determine structural arrangements

When designing experiments, researchers should focus on the transmembrane domains of AIM38, as these are likely involved in interactions within the membrane environment. The sequence containing "AISAIIFKVLPR" represents a potential transmembrane domain that may be critical for function .

Studies have shown that AIM38/Rcf2 interacts with specific subunits of Complex IV, potentially including Cox3, similar to the interaction pattern observed with Rcf1 . When analyzing these interactions, it's crucial to control for detergent effects, as the choice of detergent can significantly impact the stability of membrane protein complexes during isolation.

How can researchers effectively produce and purify recombinant AIM38 for structural and functional studies?

Producing and purifying recombinant AIM38 presents significant challenges due to its hydrophobic nature as a transmembrane protein. Based on available information, an effective protocol would include:

  • Expression System Selection:

    • E. coli-based expression systems have been successfully used for AIM38 production

    • Consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3) or C43(DE3))

    • Alternatively, yeast expression systems may provide more native-like post-translational modifications

  • Construct Design:

    • Include an N-terminal 10xHis tag for purification purposes

    • Consider using fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Include appropriate protease cleavage sites to remove tags if needed for functional studies

  • Purification Strategy:

    • Employ gentle detergents (e.g., DDM, LMNG) for membrane protein extraction

    • Use immobilized metal affinity chromatography (IMAC) as the initial purification step

    • Follow with size exclusion chromatography to achieve higher purity

  • Storage Considerations:

    • Store at -20°C for short-term use or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Consider storage at 4°C for up to one week for working aliquots

Researchers should be aware that the shelf life of the purified protein varies based on storage conditions, with liquid formulations typically stable for 6 months at -20°C/-80°C and lyophilized forms stable for up to 12 months .

What are the implications of AIM38 research for understanding human mitochondrial disorders?

Although AIM38 is specific to yeast, research on this protein has broader implications for understanding human mitochondrial disorders. The fundamental processes of respiratory chain supercomplex formation and mitochondrial inheritance have parallels in human cells, where disruptions can lead to mitochondrial diseases.

Several methodological approaches can help translate findings from yeast to human systems:

  • Bioinformatic analysis to identify potential human homologs of AIM38

  • Complementation studies using human genes in AIM38-deficient yeast

  • Comparative analysis of supercomplex formation in yeast and human mitochondria

Mitochondrial DNA mutations in humans can cause a wide range of diseases, from mild organ-specific conditions to severe disorders that often involve the nervous system . Understanding how proteins like AIM38 influence mitochondrial inheritance and function could provide insights into disease mechanisms and potential therapeutic approaches.

When designing translational studies, researchers should consider that while the maternal inheritance of mitochondria is generally accepted in humans, there are exceptions and complexities . For instance, heteroplasmy (the presence of both mutated and wild-type variant alleles within the same individual) can lead to offspring with variable severity of disease . Additionally, selection can act for and against specific mtDNA variants within the developing germ line and possibly within developing tissues .

What are the key controls and experimental design considerations for AIM38 knockout studies?

  • Multiple Knockout Verification Methods:

    • PCR verification of gene deletion

    • RT-PCR to confirm absence of transcript

    • Western blotting to confirm absence of protein

    • Complementation with wild-type gene to rescue phenotype

  • Growth Condition Considerations:

    • Test growth under both fermentative (glucose) and respiratory (glycerol, ethanol) conditions

    • Include aerobic and anaerobic environments to fully assess respiratory phenotypes

    • Monitor growth rates at different temperatures to identify conditional phenotypes

  • Mitochondrial Function Assays:

    • Oxygen consumption measurements to assess respiratory capacity

    • Membrane potential assays using fluorescent dyes (e.g., TMRM, JC-1)

    • ATP production assays to quantify energy generation efficiency

    • ROS measurements to detect potential oxidative stress

  • Genetic Background Considerations:

    • Use isogenic strains that differ only in the presence/absence of AIM38

    • Consider testing knockouts in multiple strain backgrounds to control for strain-specific effects

    • For S. cerevisiae specifically, test in both laboratory and clinical isolates, as clinical isolates may have different virulence factors

When analyzing knockout phenotypes, researchers should be aware that S. cerevisiae is remarkably adaptable and may compensate for the loss of AIM38 through alternative pathways. This necessitates careful interpretation of results and consideration of potential compensatory mechanisms.

How can researchers accurately assess the impact of AIM38 on respiratory chain function?

To accurately assess the impact of AIM38 on respiratory chain function, researchers should employ a multi-faceted approach combining biochemical, genetic, and imaging techniques:

  • Respiratory Chain Complex Activity Assays:

    • Spectrophotometric assays for individual complex activities

    • High-resolution respirometry to measure oxygen consumption

    • In-gel activity assays following blue native PAGE separation

  • Supercomplex Analysis:

    • Blue native PAGE combined with western blotting to visualize complexes

    • 2D BN/SDS-PAGE to identify individual subunits within complexes

    • Pearson correlation analysis to investigate migration patterns and detect potential changes in complex composition

  • Electron Transport Efficiency:

    • Measurement of proton pumping efficiency

    • Membrane potential quantification

    • ATP synthesis rates under different substrate conditions

  • Adaptation to Different Carbon Sources:

    • Growth rate analysis in fermentable vs. non-fermentable carbon sources

    • Gene expression changes in response to carbon source switching

    • Cellular respiration measurement using simple experimental setups

When performing these assessments, researchers should be particularly attentive to the preparation of mitochondrial samples. Isolation methods can significantly affect the integrity of supercomplexes, and detergent choice and concentration are critical parameters for blue native PAGE analysis.

The implementation of Pearson correlation analysis of protein migration patterns has proven especially valuable, as demonstrated in previous research: "Pearson correlation analysis showed that the composition of the mitochondrial complexes was unchanged under aerobic or anaerobic conditions, with the exception of complex II" .

What are the most promising areas for future research on AIM38 and related proteins?

Future research on AIM38 and related proteins should focus on several promising directions that could expand our understanding of mitochondrial biology and potentially lead to therapeutic applications:

  • Structural Biology Approaches:

    • Cryo-electron microscopy to determine the structure of AIM38 within the supercomplex

    • NMR studies of specific domains to understand protein dynamics

    • Computational modeling of protein-protein interactions to predict functional sites

  • Evolutionary Conservation Analysis:

    • Comparative genomics to identify AIM38 homologs across species

    • Functional complementation studies to test conservation of function

    • Investigation of similar proteins in pathogenic yeast species like Candida albicans

  • Translational Research Opportunities:

    • Exploration of AIM38-like proteins in human mitochondrial disease models

    • Investigation of drug compounds that modulate supercomplex formation

    • Development of biomarkers based on mitochondrial inheritance patterns

  • Advanced Genetic Approaches:

    • CRISPR-Cas9 gene editing to create specific mutations in AIM38

    • Synthetic genetic array analysis to identify genetic interactions

    • High-throughput phenotypic screens under diverse environmental conditions

When designing future studies, researchers should consider the unique adaptability of S. cerevisiae to different oxygen conditions, as these yeast can thrive in both aerobic and anaerobic environments . This adaptability makes S. cerevisiae an excellent model for studying how mitochondrial proteins like AIM38 respond to environmental changes.

Additionally, the potential role of AIM38 in pathogenicity should not be overlooked. Although S. cerevisiae is generally considered safe, it can function as an opportunistic pathogen in immunocompromised individuals . Understanding how mitochondrial function contributes to this potential for pathogenicity could provide insights into the virulence mechanisms of more aggressive fungal pathogens.

How might technologies like CRISPR-Cas9 and advanced proteomics enhance AIM38 research?

Emerging technologies offer significant potential to advance AIM38 research beyond traditional approaches:

  • CRISPR-Cas9 Applications:

    • Generation of domain-specific mutations to identify critical functional regions

    • Creation of tagged versions at endogenous loci for more physiological expression levels

    • Development of CRISPR interference systems for temporal control of AIM38 expression

    • Introduction of specific human mitochondrial disease mutations into homologous regions

  • Advanced Proteomics Approaches:

    • Proximity labeling techniques (BioID, APEX) to identify transient interaction partners

    • Thermal proteome profiling to detect conformational changes under different conditions

    • Protein correlation profiling to map complex assembly pathways

    • Cross-linking mass spectrometry for detailed interaction interface mapping

  • Single-Cell Analysis Technologies:

    • Single-cell proteomics to detect cell-to-cell variation in AIM38 expression

    • Live-cell imaging of mitochondrial dynamics with super-resolution microscopy

    • Microfluidic approaches to study individual cell responses to environmental changes

  • Systems Biology Integration:

    • Multi-omics integration (proteomics, transcriptomics, metabolomics) to understand system-wide effects

    • Network analysis to position AIM38 within broader mitochondrial function networks

    • Computational modeling of respiratory chain function with and without AIM38

These advanced technologies can build upon previous approaches such as the three-way proteomics strategy that "allows differential analysis of yeast mitochondrial membrane protein complexes under anaerobic and aerobic conditions" . By combining multiple methodological approaches, researchers can develop a more comprehensive understanding of AIM38 function within the complex mitochondrial environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.