Recombinant Saccharomyces cerevisiae ATP-dependent permease MDL1, mitochondrial (MDL1)

Shipped with Ice Packs
In Stock

Description

Functional Roles of Native MDL1

Recombinant MDL1 mirrors the biological activities of its native counterpart, which includes:

Mitochondrial Peptide Export

  • Exports peptides (600–2100 Da) generated from proteolysis of mitochondrial inner membrane proteins .

  • Critical for maintaining mitochondrial protein homeostasis .

Oxidative Stress Resistance

  • Regulates mitochondrial iron content, reducing reactive oxygen species (ROS) generation .

  • Overexpression decreases sensitivity to H₂O₂ and transition metals .

Drug and Metabolite Transport

  • Mediates mitochondrial uptake of xenobiotics (e.g., clozapine) and fluorescent dyes (e.g., safranin O) .

  • Acts as an influxer or antiporter, contrary to typical ABC transporter efflux activity .

Clozapine Uptake Studies

  • MDL1 overexpression in S. cerevisiae increases mitochondrial accumulation of clozapine by ~2-fold compared to wild-type strains .

  • Knockout strains (Δmdl1) exhibit resistance to clozapine cytotoxicity .

Metal Detoxification

  • Frameshift mutations in MDL1 correlate with enhanced molybdate resistance in yeast .

  • Modulates cellular responses to iron and copper via interactions with Fre1p and Kcs1p .

Applications in Biotechnology and Medicine

Recombinant MDL1 is utilized in:

  • Drug Transport Assays: Screening for mitochondrial-targeting therapeutics .

  • Oxidative Stress Models: Studying ROS mitigation mechanisms in neurodegenerative diseases .

  • Protein Interaction Studies: Identifying binding partners via yeast two-hybrid and co-IP approaches .

Future Directions

Current research focuses on:

  • Elucidating the structural basis of MDL1’s substrate specificity.

  • Exploring its human homolog, ABCB10, as a therapeutic target for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
MDL1; YLR188W; L9470.3; ATP-dependent permease MDL1, mitochondrial; ABC transporter MDL1; Multidrug resistance-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
101-695
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MDL1
Target Protein Sequence
KYIGLALLLILISSSVSMAVPSVIGKLLDLASESDGEDEEGSKSNKLYGFTKKQFFTALG AVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDA SIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNL SRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFF GSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGA GAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPG EHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLF NGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQ RIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTIKHST RVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQQDEEGKGGVIDLDNSVAREV
Uniprot No.

Target Background

Function
This protein mediates the export of peptides with molecular masses ranging from 2100 to 600 daltons, generated upon proteolysis of mitochondrial inner membrane proteins.
Gene References Into Functions
  1. Tom70 contributes to the presequence import pathway by recognizing the targeting signal of the Mdl1 precursor. PMID: 25958336
  2. Modes of insertion into the mitochondrial membrane of individual segments of Mdl1 and Mdl2 differ and are dependent on domain sequence context. PMID: 25128661
  3. These data explain contradicting observations on the rate-limiting step of various ABC proteins such as Mdl1 and demonstrate that dimer formation is a critical step in the ATP hydrolysis cycle. PMID: 16352609
  4. A first three-dimensional map of the mitochondrial ATP-binding cassette transporter Mdl1 complex reveals a homodimeric complex in an open conformation. PMID: 17150958
Database Links

KEGG: sce:YLR188W

STRING: 4932.YLR188W

Protein Families
ABC transporter superfamily, ABCB family, Mitochondrial peptide exporter (TC 3.A.1.212) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MDL1 and where is it localized in yeast cells?

MDL1 (encoded by YLR188W) is an ATP-dependent ABC transporter located in the inner membrane of mitochondria in Saccharomyces cerevisiae. It belongs to the ABC transporter family but displays some unusual functional characteristics compared to canonical members of this family. The protein is imported into mitochondria and integrated into the inner mitochondrial membrane where it plays roles in peptide transport and potentially in defense against oxidative stress . The mitochondrial localization of MDL1 is critical for understanding its physiological roles, as it creates a unique microenvironment for substrate concentration and transport.

What are the known physiological functions of MDL1?

MDL1 has several identified physiological functions in yeast cells:

  • Export of small peptides from mitochondria: MDL1 is required for the export of peptides with small molecular mass from the mitochondrial matrix to the cytosol .

  • Metal detoxification: The protein contributes to metal detoxification mechanisms, likely as part of cellular defenses against oxidative stress .

  • Drug transport: Recent research has revealed MDL1's unexpected role in the uptake of certain compounds such as clozapine into mitochondria, functioning as an influxer rather than the efflux function typically associated with ABC transporters .

These various functions suggest MDL1 plays a complex role in mitochondrial homeostasis and cellular detoxification pathways.

How does MDL1 differ structurally and functionally from typical ABC transporters?

MDL1 presents several notable departures from typical ABC transporters:

  • Direction of transport: While most ABC transporters function as efflux pumps that export substrates out of cells or cellular compartments, MDL1 can function as an influxer, transporting compounds like clozapine into mitochondria .

  • Possible antiporter activity: Some evidence suggests MDL1 may function as an antiporter, exchanging different molecules across the mitochondrial membrane rather than simply transporting in one direction .

  • Relationship to bacterial transporters: MDL1's function may be more closely related to certain bacterial ABC transporters, reflecting the evolutionary relationship between mitochondria and bacteria .

This unusual directionality of transport makes MDL1 particularly interesting for studying the structural determinants that influence the direction of substrate movement in ABC transporters.

What genetic approaches are effective for studying MDL1 function?

Several genetic approaches have proven effective for investigating MDL1 function:

  • CRISPR-Cas9 knockout library screening: This approach has been successfully employed to identify transporters involved in drug uptake, including MDL1. Exposing a yeast CRISPR-Cas9 knockout library to cytotoxic concentrations of compounds like clozapine can identify transporters whose absence confers resistance .

  • Overexpression systems: Complementary to knockout approaches, overexpression of MDL1 can help assess gain-of-function phenotypes. Studies show that MDL1 overexpression increases sensitivity to compounds like clozapine and enhances cellular uptake of fluorescent analogues such as safranin O .

  • Site-directed mutagenesis: Creating specific mutations in MDL1 can help identify functional domains and residues critical for transport activity, ATP binding, or substrate recognition.

  • Comparative studies with MDL2: Comparing the functions of MDL1 with its homolog MDL2 (which shares 44% sequence identity) can provide insights into functional specialization .

These genetic approaches can be combined to provide comprehensive understanding of MDL1's roles in cellular physiology.

What fluorescent probes can be used as surrogate markers for MDL1 transport activity?

Researchers have identified several fluorescent probes that can serve as surrogate markers for MDL1 transport activity:

  • Safranin O (also known as safranin T): This fluorescent dye shows structural similarity to clozapine and has been successfully used to track MDL1-mediated transport. Flow cytometry and microscopy analyses reveal that cells overexpressing MDL1 show dramatically increased uptake of safranin O into both cells and mitochondria .

  • Other potential fluorescent substrates: Based on structural similarities to known MDL1 substrates, other cationic fluorescent dyes might be useful for monitoring MDL1 activity.

When using these fluorescent probes, it is important to verify their specificity through appropriate controls, including MDL1 knockout strains and ATP-depleted conditions to confirm the transport is ATP-dependent.

How can flow cytometry be optimized for measuring MDL1-mediated transport?

Flow cytometry provides a powerful quantitative approach for measuring MDL1-mediated transport of fluorescent substrates. For optimal results:

  • Cell preparation: Ensure yeast cells are in exponential growth phase and thoroughly washed to remove media components that might interfere with dye uptake.

  • Dye concentration and incubation time: Optimize safranin O concentration (typically 1-10 μM) and incubation time (15-60 minutes) to achieve adequate signal without cytotoxicity.

  • Controls for specificity:

    • Include MDL1 knockout strains as negative controls

    • Use ATP-depleted conditions to confirm ATP-dependency

    • Include mitochondria-deficient (rho⁰) strains to confirm mitochondrial localization of transport

  • Gating strategy: Implement proper gating to exclude debris and dead cells, which may show nonspecific dye accumulation.

  • Quantification: Calculate median fluorescence intensity rather than mean values, as the latter can be skewed by outliers.

This approach allows for high-throughput screening of compounds that may interact with MDL1 and quantitative assessment of transport activity.

How does MDL1 contribute to clozapine toxicity in yeast cells?

MDL1 plays a critical role in clozapine toxicity in yeast through several mechanisms:

  • Enhanced accumulation: MDL1 facilitates the uptake of clozapine into mitochondria, leading to increased intracellular concentration of this cytotoxic compound. Strains lacking MDL1 show substantial resistance to clozapine, while overexpression of MDL1 confers extra sensitivity .

  • Mitochondrial targeting: The localization of MDL1 in mitochondria is key to its role in clozapine toxicity. Yeast strains lacking mitochondria do not show the unusual accumulation of clozapine or its analogues observed in wild-type cells .

  • Concentration effect: Mitochondria and bacteria can accumulate cations to high levels relative to the cytoplasm, which may explain why a mitochondrial transporter appears to be the primary mediator of clozapine cytotoxicity .

These findings suggest that MDL1-mediated drug uptake into mitochondria may be a significant mechanism of cytotoxicity for compounds that disrupt mitochondrial function.

What experimental design best demonstrates MDL1's role in drug uptake?

A comprehensive experimental design to demonstrate MDL1's role in drug uptake should include the following elements:

  • Genetic manipulation:

    • Compare wild-type, MDL1 knockout, and MDL1 overexpression strains

    • Include controls with related transporters (e.g., MDL2) to establish specificity

  • Growth assays with cytotoxic compounds:

    • Conduct dose-response growth curves with clozapine or similar compounds

    • Measure growth rates and calculate IC50 values for each strain

  • Direct uptake measurement:

    • Use radiolabeled compounds or fluorescent analogues

    • Measure accumulation in whole cells and isolated mitochondria

    • Include time-course experiments to assess uptake kinetics

  • ATP dependence verification:

    • Compare uptake in the presence of ATP versus non-hydrolyzable ATP analogues (AMP-PNP)

    • Deplete cellular ATP using metabolic inhibitors as a complementary approach

  • Mitochondrial function assessment:

    • Monitor mitochondrial membrane potential during drug exposure

    • Assess impact on mitochondrial respiration and ATP production

This multi-faceted approach provides robust evidence for MDL1's specific role in drug transport.

How can MDL1 research inform drug development and toxicity prediction?

Research on MDL1 can significantly impact drug development and toxicity prediction through several avenues:

  • Prediction of mitochondrial toxicity: Understanding MDL1-mediated transport can help predict compounds likely to accumulate in mitochondria and cause toxicity. The human homologue of MDL1, ABCB10, may perform similar functions .

  • Development of transport assays: Establishing high-throughput assays based on MDL1 transport activity can screen compounds for potential mitochondrial accumulation and toxicity.

  • Structural insights for drug design: Elucidating the structural features that make compounds MDL1 substrates can guide medicinal chemistry efforts to design drugs that either avoid mitochondrial accumulation or specifically target mitochondria.

  • Species differences in drug transport: Comparing MDL1 with its mammalian homologues can help understand species differences in drug toxicity, improving translation from preclinical to clinical studies.

  • Repurposing opportunities: Identifying existing drugs that interact with MDL1 may reveal new therapeutic applications targeting mitochondrial function or leveraging mitochondrial accumulation for therapeutic benefit.

What expression systems are optimal for producing recombinant MDL1?

Based on successful approaches with other membrane proteins and ABC transporters, the following expression systems can be optimized for recombinant MDL1 production:

  • Bacterial expression:

    • E. coli BL21(DE3) with helper plasmids for rare tRNAs can be effective

    • Co-expression with chaperones (e.g., trigger factor) may improve folding

    • Low-temperature induction (17°C) with reduced IPTG concentration (0.5 mM) can enhance soluble protein yield

  • Yeast expression:

    • Pichia pastoris offers advantages for membrane protein expression

    • S. cerevisiae expression allows study in the native cellular environment

    • Controlled induction using galactose-inducible promoters

  • Insect cell expression:

    • Baculovirus expression system provides eukaryotic folding machinery

    • Suitable for large-scale production of functional membrane proteins

Each system requires optimization of culture conditions, induction parameters, and extraction methods to maximize yield of functional protein.

What purification strategy yields functional MDL1 for biochemical studies?

A multi-step purification strategy for MDL1 should include:

  • Membrane preparation:

    • Cell disruption by sonication or mechanical methods in buffer containing protease inhibitors (e.g., 1 mM benzamidine, 0.2 mM PMSF)

    • Differential centrifugation to isolate mitochondrial membranes

    • Solubilization with appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography:

    • Ni-NTA purification for His-tagged MDL1

    • Incubation with resin for 3-4 hours at 4°C

    • Extensive washing with 10 mM imidazole

    • Elution with 300 mM imidazole

  • Size exclusion chromatography:

    • Superdex 200 column to remove aggregates

    • Buffer containing 2 mM MgCl₂ and stabilizing agents (10% glycerol, reducing agents)

  • Ion exchange chromatography:

    • Source 15S cation exchange for final purification

    • Linear salt gradient from 100 mM to 1 M NaCl

    • Collection of peak fractions containing pure, active protein

  • Quality control:

    • Assessment of purity by SDS-PAGE

    • Verification of ATPase activity using NADH-coupled assay

    • Analysis of oligomeric state by native PAGE or light scattering

This purification strategy, adapted from successful approaches with other ABC transporters, should yield highly pure, functional MDL1 suitable for biochemical and structural studies.

How does MDL1 compare structurally and functionally with its human homologue ABCB10?

The relationship between yeast MDL1 and human ABCB10 presents several important research questions:

  • Structural comparison:

    • Despite sequence homology, what structural differences account for potential functional divergence?

    • Do both transporters share the unusual property of acting as influxers rather than effluxers?

  • Substrate specificity:

    • Do MDL1 and ABCB10 transport similar substrates, particularly drugs and small peptides?

    • What structural determinants govern substrate recognition in each protein?

  • Physiological roles:

    • How do their roles in mitochondrial function compare across species?

    • Does ABCB10, like MDL1, contribute to drug toxicity in human cells?

  • ATP utilization:

    • Are there differences in ATP binding, hydrolysis, or coupling to transport between the two proteins?

    • How do nucleotide-binding domain interactions compare?

Studying these questions can provide evolutionary insights into ABC transporter function and potential applications in drug development and toxicity prediction.

What is the mechanism by which MDL1 mediates ATP-dependent transport?

Understanding the precise mechanism of MDL1-mediated transport requires investigation of several aspects:

  • ATP binding and hydrolysis:

    • How does ATP binding trigger conformational changes in MDL1?

    • Is transport strictly coupled to ATP hydrolysis, or can other nucleotides support activity?

    • What is the stoichiometry of ATP hydrolysis to substrate transport?

  • Transport directionality:

    • What structural features enable MDL1 to function as an influxer rather than an effluxer?

    • Is MDL1 acting as an antiporter, exchanging different molecules across the membrane?

    • How does membrane potential influence transport direction and efficiency?

  • Substrate binding:

    • Where is the substrate-binding pocket located within MDL1?

    • Do different substrates (peptides vs. drugs) bind to the same or different sites?

    • What amino acid residues are critical for substrate recognition and specificity?

  • Conformational changes:

    • How do the transmembrane domains rearrange during the transport cycle?

    • What is the role of the nucleotide-binding domains in these conformational changes?

Research addressing these questions would significantly advance our understanding of ABC transporter mechanisms and potentially reveal novel therapeutic targets.

How can researchers reconcile contradictory data on MDL1 function?

When confronting contradictory results in MDL1 research, researchers should consider:

  • Experimental conditions:

    • Different growth media and carbon sources can dramatically alter mitochondrial function

    • Temperature, pH, and osmotic conditions may affect MDL1 activity

    • Presence of other compounds that might compete for transport

  • Strain backgrounds:

    • Genetic differences between laboratory yeast strains can influence phenotypes

    • Presence of suppressors or modifiers in different genetic backgrounds

    • Variations in expression levels of MDL1 or related transporters

  • Assay limitations:

    • Direct vs. indirect measures of transport activity may yield different results

    • Whole-cell vs. isolated mitochondria experiments may not be directly comparable

    • Time-dependent effects might be missed in endpoint assays

  • Methodological approaches:

    • Design experiments that test the same hypothesis using multiple independent methods

    • Implement rigorous controls to validate each experimental approach

    • Develop quantitative assays that can detect partial or conditional effects

  • Alternative interpretations:

    • Consider dual roles where MDL1 might function differently under different conditions

    • Explore cooperative interactions with other transporters or mitochondrial proteins

    • Investigate post-translational modifications that might regulate activity

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more complete understanding of MDL1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.