Recombinant Saccharomyces cerevisiae ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Assembly-Dependent Regulation

ATP6 synthesis is tightly regulated by F₁ subunits and assembly intermediates:

  • F₁-Dependent Translation:

    • F₁ mutants (e.g., lacking α/β subunits) show impaired ATP6 translation despite normal mRNA levels .

    • The Atp22p translation factor partially rescues ATP6 synthesis in F₁-deficient strains .

  • Feedback Mechanism: Defects in ATP6 assembly upregulate its translation, suggesting a quality control system to balance subunit stoichiometry .

Mutational Studies and Pathogenicity

Recombinant ATP6 models human MT-ATP6 mutations to assess pathogenicity:

MutationEffect on ATP SynthaseClinical Relevance
m.8932C>T (yeast: a.V159I)Impaired ATP6 incorporation; reduced ATP productionNeutral in human tumors
m.8950G>A (yeast: a.V142I)Severe ATP synthase dysfunction; growth defectsPathogenic in metabolic disorders
m.9029A>G (yeast: a.H168R)Disrupted proton channel; ATP synthesis lossPathogenic in neurodegenerative diseases

These models demonstrate that conserved residues (e.g., Val142, His168) are critical for ATP6 function .

Biochemical Assays

Recombinant ATP6 is used to study:

  • Proton Channel Dynamics: Structural interactions with Atp9p and Atp8p .

  • Mutant Phenotyping: Impact of disease-associated mutations on ATP synthase assembly .

Biotechnology

  • Protein Purification: His-tag enables efficient isolation for crystallization or cryo-EM studies .

  • Therapeutic Targets: Insights into ATP synthase dysfunction in mitochondrial disorders .

Challenges and Future Directions

  • Stability: Recombinant ATP6 requires storage at -20°C/-80°C to prevent degradation .

  • Functional Reconstitution: Challenges in reassembling ATP6 with F₀/F₁ components in vitro .

  • In Vivo Models: Expanding yeast models to study MT-ATP6 variants in complex disease contexts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize development with the specified tag.
Synonyms
ATP6; OLI2; OLI4; PHO1; Q0085; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
11-259
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ATP6
Target Protein Sequence
SPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLI SQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIIS LSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSN ILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTAS YLKDAVYLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) synthesizes ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by the electron transport complexes of the respiratory chain. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and potentially plays a direct role in proton translocation across the membrane.
Gene References Into Functions
  1. The T9185C and T9191C ATP synthase two pathogenic human mitochondrial DNA mutations correlate with the severity phenotypes of two mitochondrial human diseases. PMID: 24316278
  2. Analysis of the structure of the yeast F1Fo-ATP synthase dimer and its role in shaping the mitochondrial cristae PMID: 22864911
  3. Two subunits 6 are close in the inner mitochondrial membrane and in the solubilized supramolecular forms of the yeast ATP synthase. PMID: 21868388
  4. Although the oxidative phosphorylation capacity was reduced in atp6-T9176C yeast, the number of ATP molecules synthesized per electron transferred to oxygen was similar compared with wild type yeast. PMID: 20056103
  5. atp6 mutant exhibited unusual mitochondrial structure and distribution anomalies PMID: 17261589
  6. Mitochondrial morphology is profoundly altered in the human mutant atp6-L247R. PMID: 19454486

Show More

Hide All

Database Links

KEGG: sce:Q0085

STRING: 4932.Q0085

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the genetic origin of ATP6 in Saccharomyces cerevisiae and how does this impact recombinant expression?

ATP6 (also called subunit a) is a mitochondrially-encoded component of the F0 portion of ATP synthase in Saccharomyces cerevisiae. Unlike nuclear-encoded subunits, the mitochondrial localization of the ATP6 gene creates unique challenges for genetic manipulation using conventional techniques. This genetic origin necessitates specialized approaches for recombinant expression, including allotopic expression (expressing mitochondrial genes from nuclear DNA), which often faces challenges in proper targeting and assembly. Similar challenges have been observed with other mitochondrially-encoded components, as demonstrated by studies on COX6, which showed poor complementation when expressed allotopically .

  • How does ATP6 contribute to ATP synthase assembly and function in yeast?

ATP6 forms a critical part of the proton channel in the F0 sector of ATP synthase, enabling proton flow across the inner mitochondrial membrane to drive ATP synthesis. The assembly of ATP synthase involves coordinated incorporation of both nuclear and mitochondrially-encoded subunits. Research has shown that specific protein complexes serve as assembly intermediates, similar to the Atco complexes formed between Cox6 and Atp9 that regulate ATP synthase assembly . For ATP6, specific assembly factors (including Atp10 and Atp23) facilitate its incorporation into the F0 sector. Methodologically, researchers can track ATP6 assembly using pulse-chase experiments, blue-native gel electrophoresis, and co-immunoprecipitation with known assembly factors.

  • What techniques are available for genetic manipulation of ATP6 in S. cerevisiae?

The mitochondrial location of the ATP6 gene necessitates specialized techniques for genetic manipulation. These include:

  • Mitochondrial transformation using biolistic delivery, where DNA constructs containing the desired ATP6 variants are introduced into mitochondria using a gene gun

  • Synthetic genetic array analysis to identify genetic interactions with ATP6

  • ARG8m reporter systems, where a nuclear arginine biosynthetic gene is engineered for mitochondrial expression

  • Creation of rho- petite mutants with defined mitochondrial DNA segments containing ATP6

  • Allotopic expression systems, although these face efficiency challenges similar to other mitochondrially-encoded proteins

Each approach has specific advantages and limitations that researchers must consider based on their experimental questions and available resources.

  • What methods can distinguish between functional and non-functional recombinant ATP6?

Functional assessment of recombinant ATP6 requires multiple complementary approaches. Researchers should implement growth phenotype analysis on non-fermentable carbon sources (e.g., glycerol or ethanol) as an initial screen, as functional ATP synthase is required for respiratory growth. For more precise quantitative assessment, direct measurement of ATP synthesis rates in isolated mitochondria provides crucial information about ATP6 functionality. Additionally, membrane potential measurements using fluorescent dyes help determine if the proton channel function of ATP6 remains intact. Blue-native PAGE analysis reveals whether recombinant ATP6 properly incorporates into the complete ATP synthase complex, while oxygen consumption rate measurements indicate if the entire respiratory chain functions correctly. The integration of these approaches provides comprehensive assessment of ATP6 functionality.

  • How do researchers overcome challenges in expressing and purifying recombinant ATP6?

The hydrophobic nature and mitochondrial encoding of ATP6 present significant purification challenges. Successful strategies include:

  • Using specialized detergents (like digitonin or n-dodecyl-β-D-maltoside) for membrane protein extraction

  • Engineering fusion tags that don't interfere with membrane insertion

  • Developing mild solubilization conditions that maintain native protein conformation

  • Implementing size-exclusion chromatography to isolate intact ATP synthase complexes

  • Applying specialized 2D gel techniques that separate based on both charge and hydrophobicity

For recombinant expression, researchers often use allotopic expression with mitochondrial targeting sequences, though this approach faces efficiency challenges similar to those observed with other mitochondrially-encoded proteins like Cox6 .

Advanced Research Questions

  • What protocols are most effective for site-directed mutagenesis of ATP6 in S. cerevisiae mitochondria?

Mitochondrial transformation for ATP6 mutagenesis involves several critical steps:

  • Design of mutation cassettes with extensive homologous regions (>500 bp) flanking the desired mutation

  • Biolistic transformation using DNA-coated gold particles delivered to respiration-deficient rho0 cells

  • Co-transformation with selectable markers, typically mitochondrial introns that restore respiratory function

  • Selection of transformants on non-fermentable media, which requires successful mitochondrial transformation

  • Screening by PCR and sequence verification to confirm the desired mutations

  • Confirmation of heteroplasmy/homoplasmy through multiple rounds of selection

Alternatively, some researchers use counterselectable markers or split-gene systems where essential gene functions are divided between nuclear and mitochondrial components, allowing selection for mitochondrial transformation events. The specific protocol must be tailored to the particular mutation and strain background being studied.

  • How can researchers evaluate the impact of ATP6 mutations on mitochondrial bioenergetics?

A comprehensive bioenergetic analysis of ATP6 mutations requires multiple approaches:

These measurements should be performed under various substrate conditions (NADH-linked, succinate, fatty acids) to comprehensively characterize the bioenergetic consequences of ATP6 mutations. Integration of these measurements provides mechanistic insights beyond simple growth phenotypes.

  • What are the interactions between ATP6 and other components of the respiratory chain in S. cerevisiae?

ATP6 participates in both structural and functional interactions with other respiratory components. Evidence suggests coordinated assembly of ATP synthase with cytochrome oxidase (COX), similar to the Atco complexes formed between Cox6 and Atp9 that serve as an assembly intermediate for ATP synthase . This coordination ensures proper stoichiometry between the respiratory complexes. Methodologically, researchers can investigate these interactions through:

  • Crosslinking studies followed by mass spectrometry identification

  • Co-immunoprecipitation experiments with antibodies against various respiratory components

  • Blue-native PAGE to visualize respiratory supercomplexes

  • Proximity labeling techniques to identify proteins in close proximity to ATP6

  • Genetic interaction studies examining synthetic phenotypes between ATP6 and respiratory chain mutations

These approaches can reveal both physical and functional interactions between ATP synthase and other respiratory complexes, providing insights into the integrated regulation of oxidative phosphorylation.

  • How do lipid-protein interactions affect ATP6 function and assembly in the mitochondrial membrane?

ATP6 function depends critically on the lipid environment of the inner mitochondrial membrane. Researchers studying these interactions should employ:

  • Lipidomic analysis of purified ATP synthase complexes to identify associated lipids

  • Reconstitution experiments in defined lipid compositions to determine functional requirements

  • Site-specific labeling of ATP6 combined with lipid probes to identify interaction sites

  • Molecular dynamics simulations to model lipid-ATP6 interactions

  • Genetic manipulation of mitochondrial lipid biosynthesis pathways to alter membrane composition

Cardiolipin, a mitochondria-specific phospholipid, plays a particularly important role in ATP synthase function and assembly. Methodologically, researchers can use cardiolipin-deficient mutants (Δcrd1) to investigate how altered lipid composition affects ATP6 incorporation and ATP synthase activity. These approaches help define the lipid requirements for optimal ATP6 function.

  • What experimental approaches are recommended for studying the co-regulation of ATP synthase and cytochrome oxidase assembly?

Recent research indicates coordinated assembly of ATP synthase and cytochrome oxidase. In S. cerevisiae, the Atco complex containing Cox6 and Atp9 serves as a source of Atp9 for ATP synthase assembly . This suggests a regulatory mechanism in which Atco unidirectionally couples the biogenesis of COX to that of ATP synthase to maintain proper stoichiometry . To study such co-regulation involving ATP6, researchers should:

  • Perform pulse-labeling experiments similar to those used for Cox6 to track newly synthesized ATP6 and its incorporation into assembly intermediates

  • Use blue-native PAGE followed by second-dimension SDS-PAGE to identify assembly intermediates containing ATP6

  • Create conditional mutants of assembly factors to determine their impact on both ATP synthase and COX assembly

  • Implement proteomics approaches to identify proteins that interact with both ATP synthase and COX components

  • Develop in organello translation systems to study the coordination of mitochondrial protein synthesis

These approaches can reveal whether ATP6 participates in similar coordinated assembly mechanisms as observed for Cox6 and Atp9.

  • How can researchers analyze the impact of ATP6 variants on mitochondrial disease models in yeast?

S. cerevisiae provides an excellent model system for studying ATP6 mutations associated with human mitochondrial diseases. Methodological approaches include:

  • Creating homologous mutations in yeast ATP6 that correspond to human pathogenic variants

  • Performing comprehensive bioenergetic analysis (as outlined in question 7)

  • Assessing the impact on mitochondrial quality control systems using proteostasis markers

  • Measuring mitochondrial translation efficiency through pulse-labeling experiments

  • Evaluating cellular responses including retrograde signaling to the nucleus

  • Testing potential therapeutic compounds for their ability to rescue mutant phenotypes

These approaches should be integrated with systems biology techniques including transcriptomics and metabolomics to characterize the broader cellular impact of ATP6 mutations. The yeast model provides a genetically tractable system to evaluate potential therapeutic strategies that might be applicable to human mitochondrial disease.

  • What are the emerging techniques for studying ATP6 dynamics in living cells?

Recent technological advances offer new opportunities for studying ATP6 dynamics:

  • Super-resolution microscopy techniques (STED, PALM, STORM) to visualize ATP6 distribution in mitochondria

  • Single-molecule tracking approaches to monitor ATP6 mobility in the inner membrane

  • FRET-based sensors to detect conformational changes during ATP synthesis

  • Optogenetic tools to manipulate ATP6 function with light-sensitive domains

  • In-cell NMR techniques to study structural dynamics in native environments

These approaches must overcome challenges including the small size of yeast mitochondria and the hydrophobic nature of ATP6. Methodologically, researchers can use split-fluorescent protein approaches or minimal tagging strategies that maintain ATP6 function while enabling visualization. These emerging techniques promise new insights into the dynamic behavior of ATP6 during ATP synthase operation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.