Recombinant Saccharomyces cerevisiae Beta-1,6-glucan synthesis-associated protein KEG1 (KEG1)

Shipped with Ice Packs
In Stock

Description

Introduction to KEG1

KEG1 (UniProt ID: P43614) is an integral membrane protein localized to the endoplasmic reticulum (ER) in S. cerevisiae. It plays a critical role in synthesizing β-1,6-glucan, a structural polysaccharide essential for cell wall integrity . Recombinant KEG1 is produced to study its molecular interactions and applications in antifungal drug development.

Functional Role in β-1,6-Glucan Biosynthesis

KEG1 cooperates with Kre6, a β-glucan synthase homolog, to ensure proper glucan chain assembly . Key mechanisms include:

  • Binding to Kre6: Physical interaction stabilizes Kre6, preventing ER-associated degradation (ERAD) .

  • Polarized Localization: Directs Kre6 to bud sites for localized cell wall synthesis .

  • Chaperone-like Activity: Assists in folding Kre6 and its paralog Skn1, ensuring their functional conformation .

Genetic and Physical Interactions

KEG1 exhibits synthetic lethality with calnexin cycle homologs (CWH41, ROT2, CNE1), highlighting its role in ER quality control . Key interactors include:

InteractorFunctionInteraction ScoreSource
Kre6β-1,6-glucan synthase0.931
Rot1ER chaperone for glycosylation0.927
Skn1Kre6 paralog with overlapping roles0.669

Mutant Phenotypes

  • Temperature Sensitivity: keg1-1 mutants show reduced β-1,6-glucan levels, Calcofluor white hypersensitivity, and impaired Kre6 stability at 30°C .

  • ERAD Susceptibility: In keg1-1, Kre6 degradation accelerates by 40–60% compared to wild-type .

  • Antifungal Target: Jervine, a steroidal alkaloid, inhibits β-1,6-glucan synthesis by targeting Kre6/Skn1, with keg1-1 mutants showing heightened sensitivity .

Biochemical Assays

Recombinant KEG1 is used in ELISA-based quantification of β-1,6-glucan (e.g., using Neg1-E321Q-His as a detection probe) . Key assay parameters:

ParameterSpecification
Detection Limit0.1–10 μg/ml (pustulan standard)
Coating Concentration2 μg/ml Neg1-E321Q-His
Signal DetectionLuminescence via HRP-streptavidin

Drug Discovery

  • Target Validation: Used to screen inhibitors like jervine, which reduces β-1,6-glucan by 30–50% in wild-type strains .

  • Gene Interaction Studies: Identifies synthetic lethal partners for combinatorial antifungal therapies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
KEG1; YFR042W; Beta-1,6-glucan synthesis-associated protein KEG1; KRE6-binding ER protein responsible for glucan synthesis protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
KEG1
Target Protein Sequence
MAGIKLTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIME VIWLLRFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQ AYCHWCKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINR VVLLAYFPVLLTAYKKLLTK
Uniprot No.

Target Background

Function
KEG1 is involved in the biosynthesis of (1->6)-beta-D-glucan polymers within the cell wall. This protein is crucial for cell viability and plays a role in maintaining chromosome stability.
Gene References Into Functions
  1. Keg1 and Kre6 exhibit a cooperative function in beta-1,6-glucan synthesis within S. cerevisiae. PMID: 17893149
Database Links

KEGG: sce:YFR042W

STRING: 4932.YFR042W

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is KEG1 and what is its fundamental role in Saccharomyces cerevisiae?

KEG1/YFR042w is an essential gene in Saccharomyces cerevisiae that encodes a 200-amino acid polypeptide with four predicted transmembrane domains . The protein functions as a critical component in beta-1,6-glucan synthesis machinery, working cooperatively with Kre6 in the endoplasmic reticulum (ER) .

Experimental evidence for KEG1's role comes from temperature-sensitive mutant alleles constructed through error-prone polymerase chain reaction. The keg1-1 mutant cells display phenotypes remarkably similar to Δkre6 mutants, including hypersensitivity to Calcofluor white, reduced sensitivity to K1 killer toxin, and significantly reduced beta-1,6-glucan content in the cell wall . These parallel phenotypes strongly suggest that Keg1 and Kre6 have functionally interdependent roles in beta-1,6-glucan synthesis pathways in S. cerevisiae.

How is KEG1 structurally characterized and localized within the cell?

KEG1 encodes a 200-amino acid polypeptide characterized by four predicted transmembrane domains . When tagged with either green fluorescent protein (GFP) or Myc(6), the Keg1 protein exhibits typical characteristics of an integral membrane protein, firmly anchored within the endoplasmic reticulum membrane as confirmed by fluorescence imaging techniques .

The protein's transmembrane topology positions it optimally for interaction with binding partners involved in beta-1,6-glucan synthesis, particularly Kre6. While Keg1 itself remains predominantly in the ER, it facilitates the proper localization of Kre6, which shows a unique distribution pattern with significant portions found in the plasma membrane of buds . This polarized appearance of Kre6 at bud sites is essential for beta-1,6-glucan synthesis and becomes disrupted in keg1-1 mutant cells .

What is the relationship between KEG1 and Kre6 proteins?

The relationship between Keg1 and Kre6 represents a critical protein-protein interaction in the beta-1,6-glucan synthesis pathway. Immunoprecipitation experiments from Triton X-100-solubilized cell lysates have conclusively demonstrated that Keg1 physically binds to Kre6 . This binding interaction appears essential for Kre6's stability and function.

In keg1-1 mutant cells, three significant disruptions occur: (1) the binding of Kre6 to Keg1 is substantially decreased, (2) accumulation of Kre6 at the buds is diminished, and (3) Kre6 becomes highly susceptible to ER-associated degradation (ERAD) . These findings suggest that Keg1 functions as a specialized chaperone-like protein that participates in the proper folding and transport of Kre6, which is necessary for Kre6 to function effectively in beta-1,6-glucan synthesis . Without proper Keg1 function, Kre6 cannot maintain its correct conformation and localization, leading to degradation and subsequent defects in beta-1,6-glucan synthesis.

How do mutations in KEG1 affect beta-1,6-glucan synthesis and cell wall integrity?

Mutations in KEG1 produce profound effects on beta-1,6-glucan synthesis and consequently on cell wall integrity. The temperature-sensitive keg1-1 mutant cells exhibit several distinct phenotypes:

  • Significantly reduced beta-1,6-glucan content in the cell wall

  • Hypersensitivity to Calcofluor white, a compound that binds to cell wall polysaccharides

  • Reduced sensitivity to K1 killer toxin, which requires beta-1,6-glucan for initial cell wall binding

  • Diminished accumulation of Kre6 at the buds

  • Decreased binding between Kre6 and Keg1

  • Increased susceptibility of Kre6 to ER-associated degradation

These phenotypic changes demonstrate that Keg1 is essential for maintaining proper cell wall composition through its effects on beta-1,6-glucan synthesis. The experimental approach to identifying these effects typically involves comparing wild-type, keg1-1 mutant, and Δkre6 mutant cells under various conditions, including exposure to cell wall-perturbing agents and analysis of cell wall composition through biochemical fractionation and quantification techniques.

What experimental methods are commonly used to study KEG1 expression and function?

Several experimental approaches are employed to study Keg1 expression and function:

  • Protein Tagging and Localization:

    • Fusion of GFP or Myc(6) tags to Keg1 for fluorescence imaging and localization studies

    • Immunofluorescence to detect the distribution patterns of Keg1 and its binding partners

  • Protein-Protein Interactions:

    • Immunoprecipitation from Triton X-100-solubilized cell lysates to detect binding between Keg1 and Kre6

    • Co-immunoprecipitation to identify multi-protein complexes involving Keg1, Kre6, and ER chaperones like Cne1

  • Genetic Manipulation:

    • Construction of temperature-sensitive mutant alleles using error-prone PCR

    • Generation of deletion mutants and double-mutants to study genetic interactions

  • Phenotypic Characterization:

    • Calcofluor white sensitivity assays

    • K1 killer toxin sensitivity tests

    • Growth analysis under various stress conditions

  • Cell Wall Analysis:

    • Fractionation and quantification of beta-1,6-glucan content

    • Incorporation studies using 14C-labeled glucose

These methodological approaches provide complementary data that collectively illuminate Keg1's essential role in beta-1,6-glucan synthesis and cell wall integrity.

What molecular mechanisms underlie the Keg1-Kre6 interaction in beta-1,6-glucan synthesis?

The molecular mechanisms governing the Keg1-Kre6 interaction involve a complex interplay of protein folding, quality control, and transport processes within the endoplasmic reticulum. Current mechanistic models suggest:

  • Keg1 functions as a specialized chaperone-like protein that binds to Kre6 in the ER, facilitating its proper folding and preventing aggregation

  • This interaction protects Kre6 from premature degradation through the ER-associated degradation (ERAD) pathway

  • Properly folded Kre6 can then be transported to the plasma membrane of buds, where it functions in beta-1,6-glucan synthesis

  • In keg1-1 mutant cells, the binding between Keg1 and Kre6 is compromised, leading to Kre6 misfolding, degradation, and reduced accumulation at bud sites

The interaction appears to be specific and direct, as demonstrated by immunoprecipitation studies . The molecular details of the binding interface between these proteins remain an area of active investigation, with particular interest in how the transmembrane domains of both proteins might contribute to their interaction.

It's noteworthy that this Keg1-Kre6 interaction represents just one component of a larger network of ER quality control proteins that collectively ensure proper folding and localization of proteins involved in beta-1,6-glucan synthesis.

How do multiple endoplasmic reticulum chaperone-like proteins cooperate with KEG1?

KEG1 functions within a sophisticated network of ER chaperone-like proteins that collectively ensure proper folding and localization of Kre6. Research has revealed several key interactions and functional relationships:

  • The endoplasmic reticulum chaperone Rot1 binds to Kre6, suggesting multiple chaperones work together to ensure proper Kre6 folding

  • Cne1 (the yeast homologue of calnexin) co-immunoprecipitates with both Keg1 and Kre6, indicating a potential three-way interaction or complex formation

  • The binding of Cne1 to Kre6 is enhanced when two glucosidases (Cwh41 and Rot2) that remove glucose on N-glycan are functionally active, suggesting glycosylation-dependent quality control

  • All mutants of the calnexin cycle member homologues (cwh41, rot2, kre5, and cne1) show defects in beta-1,6-glucan synthesis, despite the calnexin chaperone system being generally considered non-functional in yeast

  • Synthetic defects are observed between calnexin cycle mutants and keg1-1, indicating functional overlap or cooperation

These findings collectively suggest that proper folding and localization of Kre6 requires the coordinated action of multiple ER chaperone-like proteins, including Keg1, Rot1, and components of the calnexin cycle. This represents a sophisticated quality control system dedicated to ensuring the functionality of proteins involved in beta-1,6-glucan synthesis.

What are the methodological approaches for quantifying beta-1,6-glucan synthesis in relation to KEG1 function?

Quantifying beta-1,6-glucan synthesis in relation to KEG1 function requires specialized methodological approaches that can isolate and measure this specific cell wall component:

  • Radioactive Labeling and Fractionation:

    • Cells are cultured in the presence of [14C]glucose to metabolically label newly synthesized cell wall components

    • Cell wall fractions are prepared using a protocol involving trichloroacetic acid treatment followed by mild alkaline extraction (1N NaOH at 75°C)

    • Zymolyase treatment (5 mg/ml Zymolyase 100T) at 37°C for 20 hours is used to separate different glucan fractions

    • Centrifugation through specialized separation filters isolates beta-1,6-glucan from beta-1,3-glucan fractions

    • Scintillation counting quantifies the radioactivity in each fraction, providing a measure of newly synthesized beta-1,6-glucan

  • Beta-1,6-Glucan-Specific Probes:

    • Recently developed beta-1,6-glucan-specific probes (e.g., modified recombinant Neg1) provide more direct detection methods

    • These probes overcome previous limitations in visualizing and quantifying beta-1,6-glucan specifically

  • Indirect Phenotypic Assays:

    • K1 killer toxin sensitivity assays provide an indirect measure of beta-1,6-glucan content, as the toxin binds to this cell wall component in its first step of action

    • Growth inhibition zones on plates containing K1 killer toxin correlate with beta-1,6-glucan content

  • Inhibitor Studies:

    • Compounds like jervine specifically inhibit beta-1,6-glucan biosynthesis in a dose-dependent manner

    • Measuring the effects of such inhibitors on wild-type versus keg1 mutant cells provides insights into Keg1's role in the synthesis pathway

These methodological approaches provide complementary data on beta-1,6-glucan synthesis and have been instrumental in elucidating Keg1's role in this process.

How do inhibitors of beta-1,6-glucan synthesis interact with the KEG1-Kre6 system?

The study of specific inhibitors has provided valuable insights into the KEG1-Kre6 system's role in beta-1,6-glucan synthesis. Jerveratrum-type steroidal alkaloids, particularly jervine, have emerged as useful tools:

  • Jervine specifically inhibits beta-1,6-glucan biosynthesis in yeast, as demonstrated by:

    • Significantly decreased growth inhibition zones in K1 killer toxin assays at 5-10 μg/ml concentrations

    • Reduced incorporation of 14C-labeled glucose specifically into the beta-1,6-glucan fraction in a dose-dependent manner

    • No significant effect on beta-1,3-glucan or chitin fractions, confirming specificity

  • Resistance patterns to jervine reveal functional aspects of the Kre6/Skn1 proteins:

    • The Kre6(F552I) mutation renders cells insensitive to jervine

    • The Skn1(F604I) mutation confers weak protection against jervine

    • Combined mutations [Kre6(F552I) SKN1(F604I)] provide dramatically increased resistance

  • Quantitative inhibition data shows striking strain-dependent differences in jervine sensitivity:

Strain descriptionIC50 (μg/mL)SE
KRE6 SKN19.6020.558
KRE6(F552I) SKN1101.7321.006
KRE6 skn1Δ11.8940.225
kre6Δ SKN10.3630.019
KRE6 SKN1(F604I)12.5160.467
kre6Δ SKN1(F604I)80.3220.992
KRE6(F552I) Δskn145.1340.987
KRE6(F552I) SKN1(F604I)700.2250.999

These findings suggest that jervine acts directly on Kre6 and its homologue Skn1, inhibiting beta-1,6-glucan biosynthesis . The dramatically increased IC50 value (700.225 μg/mL) for the double mutant [KRE6(F552I) SKN1(F604I)] compared to wild-type (9.602 μg/mL) indicates that these specific residues are likely involved in inhibitor binding or action .

The relationship between these inhibitors and Keg1 appears to be indirect - jervine targets Kre6/Skn1, while Keg1's role remains centered on ensuring proper folding and localization of these proteins.

What are the current methodological challenges and future directions in KEG1 research?

Several significant methodological challenges persist in the study of KEG1 and beta-1,6-glucan synthesis, guiding future research directions:

  • Incomplete Understanding of Beta-1,6-Glucan Synthesis:

    • Despite identification of many factors involved in beta-1,6-glucan biosynthesis, the complete pathway remains unclear

    • Unlike beta-1,3-glucan synthase (where Fks1 is the known catalytic subunit), the catalytic subunit of beta-1,6-glucan synthase has not been identified

    • Kinetic studies of beta-1,6-glucan chain formation present technical challenges compared to beta-1,3-glucan

  • Detection and Visualization Limitations:

    • While tools like aniline blue effectively stain beta-1,3-glucan, specific staining methods for beta-1,6-glucan and its intermediates have been limited

    • Recently developed beta-1,6-glucan-specific probes represent promising advances but require further refinement

  • Membrane Protein Analysis Complexities:

    • As integral membrane proteins, Keg1 and Kre6 present inherent challenges for structural studies

    • Maintaining native conformations and interactions during solubilization and purification requires specialized approaches

  • Future Research Directions:

    • Structural determination of the Keg1-Kre6 complex would provide mechanistic insights into their interaction

    • Identification of the catalytic subunit of beta-1,6-glucan synthase remains a critical goal

    • Further elucidation of how multiple ER chaperone systems coordinate to ensure proper folding of proteins involved in cell wall synthesis

    • Development of more specific inhibitors based on understanding of the synthesis pathway could provide both research tools and potential antifungal targets

Addressing these challenges will require integrating advanced structural biology techniques with genetic, biochemical, and cell biological approaches to fully elucidate the role of Keg1 in beta-1,6-glucan synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.