Recombinant Saccharomyces cerevisiae Bud site selection protein 8 (BUD8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
BUD8; YLR353W; L9638.3; Bud site selection protein 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-603
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
BUD8
Target Protein Sequence
MIQSDEDNLDSSETTASTSYSGTSSVSSRLQLRTSLFFENLNGAHGNPDAETEMATVAYE TTSRGQGFAVYINNERFSQIMGASTSSSSSSNSSSITQFHDTQDNNIPSNTTVRPTSLRR DNEDTVPLRNVTPSQNAAVRPERAVNSPSSQRLSCALTISTSVLMGEDVEGSPIEQEHSR VVSSLYSSLANRGNDESKNGTPPRPTSIEPNETTEHSFFSYHYDDTLEPDVEEAVRLTKN KTSNVNFISSTGSKGEGETEDEVIDQYEPVNESKFIPHKLKIPEKAGSIKSSTSDDSHSP GAPGTSARKIKIPQSPSLIGNILIPSHNSDSSNESSPKDHIGHNNEEKFSSKSTRKPSTS LEEEGPPIGLPSIPVLRSVSGPSKWTKTPLRLESGNSTKSDPFSRYEGHKTPSPLTKMNK KKNKTLPEHGQPLVLAPIKSQSSESDTGQNSIIEKPARSIRRKQQEKTDNRKEDRHDAEN IDLEARMPIQHIDTASIHSFDSGQNGFRDVYSIENIIVILLCCSIVPPLFFIIGCSSRRK LVSDYRLMRLLMNKEHRAALLQGFIWDVDLRWFRMFCLILGAAETVIVMAGIAIGFGVGI TRE
Uniprot No.

Target Background

Function
Potentially involved in the localization of the distal bud pole signal.
Gene References Into Functions
  1. Bud8p and Bud9p possess distinct domains facilitating their delivery to cell poles, interaction with the general budding machinery, and association with other cortical tag proteins. PMID: 17581861
Database Links

KEGG: sce:YLR353W

STRING: 4932.YLR353W

Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Found at presumptive bud sites, bud tips, and the distal poles of daughter cells.

Q&A

What is BUD8 protein and what role does it play in yeast cell division?

BUD8 is a transmembrane protein that functions as a spatial landmark for bud site selection in Saccharomyces cerevisiae. It serves as a cortical tag that marks the distal pole of both yeast form (YF) and pseudohyphal (PH) cells, where it directs the initiation of cell division . Functionally, BUD8 is essential for bipolar budding patterns in diploid cells and for the unipolar-distal pattern observed during haploid invasive growth . Deletion of BUD8 causes a unipolar proximal budding pattern in both yeast form cells and pseudohyphal filaments, demonstrating its critical role in establishing cell polarity during division .

How is BUD8 structurally organized to perform its function?

BUD8 contains distinct functional domains that contribute to its role as a spatial landmark:

  • An extracytoplasmic domain that appears to be critical for its function

  • Transmembrane segments that anchor the protein to the cell membrane

  • Cytoplasmic domains involved in signaling

Experimental evidence demonstrates that the extracytoplasmic domain of BUD8 is particularly important for its functional specificity. When this domain is fused to the transmembrane and cytoplasmic domains of BUD9 (another bud site selection protein), the chimeric protein rescues the bud8/bud8 mutant phenotype as effectively as full-length BUD8 . This indicates that while the transmembrane and cytoplasmic domains of BUD8 and BUD9 appear interchangeable, the extracytoplasmic domain confers the specific functionality of BUD8 in marking the distal pole .

How is BUD8 expression regulated during the cell cycle?

BUD8 expression exhibits distinct cell cycle-dependent regulation. Northern blot analyses reveal that BUD8 mRNA shows peak expression during M phase of the cell cycle . This tightly controlled temporal expression pattern is critical for establishing proper bud site selection during cell division.

In contrast, BUD9 (which marks the proximal pole) shows peak expression in G1 phase . This differential timing of expression contributes to the establishment of distinct spatial landmarks at opposite poles of the cell. The expression patterns can be visualized in the following experimental results:

ProteinPeak Expression PhaseFunction
BUD8M phaseMarks distal pole
BUD9G1 phaseMarks proximal pole

Intriguingly, when BUD8 is expressed under the control of the BUD9 promoter, it can rescue proximal-pole budding in bud9/bud9 mutants . This experimental evidence suggests that the timing of expression, controlled by promoter elements, plays a significant role in determining where these proteins are localized and function.

What experimental approaches can be used to study BUD8 expression?

Several methodological approaches have proven effective for studying BUD8 expression:

  • Northern blot analysis: Used to detect BUD8 mRNA levels throughout the cell cycle in synchronized cultures .

  • Promoter swapping: Replacing the native BUD8 promoter with other promoters (e.g., the BUD9 promoter or the MET25 promoter) to study the effects of altered expression timing and levels .

  • Cell synchronization: Methods such as α-factor arrest and release or cdc15 arrest and release can be used to synchronize yeast cells for studying cell cycle-dependent expression .

  • Reporter gene fusions: Constructing fusions between the BUD8 promoter and reporter genes to study promoter activity.

These approaches have revealed that while the timing of BUD8 expression is critical for its proper localization and function, expressing BUD8 from the MET25 promoter did not affect its subcellular localization compared to expression from its endogenous promoter .

How can BUD8 protein be visualized in living cells?

Several effective techniques have been developed to visualize BUD8 localization:

  • GFP fusion proteins: The most widely used approach involves creating N-terminal fusions between GFP and BUD8. This can be accomplished by introducing a BglII site in front of the second codon of BUD8 and inserting a fragment encoding the GFPuv variant . These fusions can be expressed under the control of either the native BUD8 promoter or heterologous promoters such as MET25.

  • Epitope tagging: BUD8 can be tagged with epitopes such as the myc epitope, allowing detection via immunofluorescence or western blotting .

  • Time-lapse microscopy: This technique enables the visualization of BUD8 localization dynamics during cell division and enables researchers to distinguish between different budding patterns .

When using these techniques, researchers should consider the following methodological guidelines:

  • Verify that the fusion protein is functional by testing its ability to complement bud8Δ mutants

  • Include appropriate controls to ensure that the tag does not interfere with protein localization or function

  • Use cell wall staining (e.g., with Calcofluor) to visualize bud scars in conjunction with protein localization

What is the subcellular localization pattern of BUD8?

BUD8 protein shows a highly specific localization pattern that correlates with its function:

  • BUD8 is highly concentrated at the distal pole of both yeast form and pseudohyphal cells

  • This localization is consistent with its role in directing bud initiation at the distal pole

  • The localization of BUD8 is maintained even in haploid cells, despite these cells displaying an axial budding pattern

  • Interestingly, in haploid cells, the presence of asymmetrically localized BUD8 is not sufficient to induce bipolar budding, likely due to the presence of haploid-specific budding proteins that override BUD8 function

The localization pattern of BUD8 is not significantly altered during the transition from yeast form to pseudohyphal growth in response to nitrogen starvation . This suggests that the mechanism that controls the switch in budding pattern during pseudohyphal development involves factors beyond simply changing BUD8 localization.

What are the phenotypic consequences of BUD8 deletion?

Deletion of BUD8 results in distinct phenotypic changes that reveal its function in bud site selection:

  • Altered budding pattern: Full deletion of BUD8 causes a unipolar proximal budding pattern in both yeast form cells and pseudohyphal filaments . This contrasts with the bipolar pattern in wild-type yeast form cells and the unipolar distal pattern in pseudohyphal filaments.

  • Suppression of pseudohyphal filament formation: BUD8 deletion completely suppresses the formation of pseudohyphal filaments when tested on nitrogen starvation media . This phenotype underscores the importance of proper bud site selection for filamentous growth.

  • Preserved cell morphology changes: Despite the altered budding pattern, changes in cell shape during pseudohyphal development are not affected in bud8 mutants . This indicates that BUD8 specifically affects bud site selection rather than other aspects of cell morphology.

  • Preserved invasive growth capability: The substrate-invasive growth capability remains similar in wild-type and bud8 diploid mutants . This suggests that while BUD8 is essential for proper budding pattern, it is not required for the invasive growth behavior associated with pseudohyphal development.

How can BUD8 function be analyzed through genetic manipulation?

Several genetic approaches have proven valuable for dissecting BUD8 function:

  • Gene deletion: Constructing homozygous diploid strains with full deletions of BUD8 using standard gene replacement techniques .

  • Complementation analysis: Transforming bud8 mutant strains with plasmids containing the wild-type BUD8 gene to assess rescue of the mutant phenotype .

  • Domain swapping: Creating chimeric proteins by swapping domains between BUD8 and related proteins (e.g., BUD9) to identify functional domains .

  • Promoter swapping: Expressing BUD8 under the control of different promoters (e.g., the BUD9 promoter) to assess the role of expression timing .

  • Overexpression studies: Overexpressing BUD8 from high-copy-number plasmids or from inducible promoters like MET25 or GAL1/10 to assess gain-of-function phenotypes .

One particularly informative approach involves analyzing budding patterns using bud scar staining with Calcofluor, combined with time-lapse microscopy to distinguish between unipolar proximal and unipolar distal patterns .

What proteins interact with BUD8 and how can these interactions be studied?

BUD8 engages in several key protein interactions that are critical for its function:

These interactions can be studied using the following methodological approaches:

  • Affinity purification: GST fusion proteins can be used for pulldown assays to identify interacting partners. For example, GST-BUD8 fusion proteins expressed from the GAL1 promoter can be purified with glutathione beads to isolate associated proteins .

  • Western blot analysis: Proteins purified by glutathione-agarose can be analyzed using antibodies against GST or epitope tags to detect co-purifying proteins .

  • Yeast two-hybrid assays: This system can be used to screen for potential interacting partners or to confirm suspected interactions.

  • Co-localization studies: Fluorescently tagged proteins can be examined for co-localization, which may suggest functional interaction.

How does BUD8 contribute to haploid invasive growth?

In haploid Saccharomyces cerevisiae strains, glucose depletion triggers invasive growth, a foraging response that requires a change in budding pattern from axial to unipolar-distal . BUD8 plays a critical role in this process:

  • Marking the distal pole: BUD8 is localized to the distal pole of haploid cells, despite these cells normally exhibiting an axial budding pattern under standard conditions .

  • Response to glucose limitation: During glucose limitation, BUD8 is required for the localization of Bud2p (an incipient bud site marker) to the distal pole . This suggests that BUD8 helps redirect the budding machinery to the distal pole during invasive growth.

  • Uncoupling with apical growth: In bud8 mutants under glucose-limiting conditions, apical growth and bud site selection become uncoupled processes . This indicates that BUD8 coordinates these two aspects of polarized growth during the invasive growth response.

  • Interaction with nutrient signaling: The activity of BUD8 in haploid invasive growth appears to be regulated by nutrient availability, specifically glucose levels .

Research findings indicate that proteins required for bipolar budding in diploid cells, including BUD8, are also required for haploid invasive growth . This suggests a conservation of molecular mechanisms between different types of polarized growth in yeast.

What methods are used to study BUD8 function in invasive growth?

Several specialized techniques have been developed to analyze BUD8's role in invasive growth:

  • Invasive growth assays: Involving growth of yeast on rich media containing glucose, followed by washing of surface cells to reveal cells that have invaded the agar .

  • Analysis of budding patterns: Using Calcofluor staining to visualize bud scars and determine budding patterns in glucose-limiting conditions .

  • Protein localization studies: Using GFP-tagged proteins to track the localization of BUD8 and other proteins during invasive growth .

  • Genetic analysis: Construction and characterization of strains with deletions or modifications of BUD8 and related genes to assess their roles in invasive growth .

  • Nutrient limitation experiments: Using media with different glucose concentrations to trigger and study the invasive growth response .

These methodological approaches have revealed that diploid cells starved for glucose also initiate the filamentous growth response, suggesting conservation of this mechanism across cell types .

What are the approaches for cloning and expressing recombinant BUD8?

Cloning and recombinant expression of BUD8 can be achieved through several methodological approaches:

  • Genomic library screening: BUD8 was originally cloned by transforming bud8 mutant strains with a yeast genomic DNA library and screening for complementation of the budding pattern defect . From approximately 1700 transformants examined, one showed plasmid-dependent restoration of normal bipolar budding .

  • Subcloning and vector construction: For detailed analysis of BUD8, specific fragments containing the complete BUD8 open reading frame plus upstream and downstream sequences can be subcloned into appropriate vectors:

    • A ~3.0-kb BamHI-XbaI fragment containing the entire BUD8 ORF plus 547 bp of upstream sequence and 608 bp of downstream sequence can be subcloned into vectors like pBluescript KS(+) or pRS316

    • For overexpression studies, fragments can be subcloned into high-copy vectors like YEplac181

  • Construction of expression cassettes: BUD8 can be expressed under control of various promoters:

    • Its native promoter for physiological expression

    • The GAL1/10 promoter for inducible expression

    • The MET25 promoter for regulated expression

  • Epitope tagging strategies: Various epitope tags can be added to facilitate detection and purification:

    • GFP tagging by introducing a BglII site in front of the second codon of BUD8 and inserting a fragment encoding GFP

    • GST tagging for affinity purification by creating in-frame fusions between GST and BUD8

    • myc epitope tagging for detection in western blots and immunofluorescence

What considerations are important when designing BUD8 expression constructs?

When designing constructs for BUD8 expression, researchers should consider several important factors:

  • Promoter selection: The choice of promoter significantly affects expression level and timing:

    • The native BUD8 promoter maintains normal cell cycle regulation with peak expression in M phase

    • Inducible promoters like GAL1/10 allow controlled expression for biochemical studies

    • The BUD9 promoter drives expression in G1 phase, which can alter BUD8 localization and function

  • Inclusion of regulatory sequences: Including appropriate upstream and downstream sequences is often critical for proper expression and regulation.

  • Tag position: The position of epitope tags can affect protein function:

    • N-terminal GFP fusions to BUD8 have been successfully used without disrupting function

    • Verification that tagged versions maintain biological activity is essential

  • Expression levels: Overexpression of BUD8 from high-copy-number plasmids or strong promoters significantly enhances the frequency of distal budding in yeast form cells , which should be considered when interpreting results.

  • Strain background: The genetic background of the expression strain can influence BUD8 function and localization, particularly in haploid versus diploid contexts.

How does BUD8 interact with the broader cell polarity machinery?

BUD8 functions as part of a complex network that establishes and maintains cell polarity during budding:

  • Interaction with the Rsr1p/Bud1p GTPase module: Genetic evidence suggests that BUD8 functions upstream of the Rsr1p/Bud1p GTPase, which is a key regulator of bud site selection . The finding that rsr1/bud1 mutants display a random budding pattern regardless of BUD8 status suggests that BUD8 acts through this pathway .

  • Relationship with Bud2p and Bud5p: BUD8 might control distal bud site selection via the regulatory proteins of Rsr1p/Bud1p, specifically the GTPase-activating protein Bud2p and the guanine nucleotide exchange factor Bud5p . During glucose limitation in haploid cells, BUD8 is required for the localization of Bud2p to the distal pole .

  • Connection to actin cytoskeleton: A genome-wide screen identified genes involved in actin-cytoskeleton organization as important for the bipolar budding pattern , suggesting that BUD8 function may be connected to actin organization.

  • Coordination with cell cycle machinery: The cell cycle-regulated expression of BUD8, with peak levels in M phase , indicates coordination between bud site selection and cell cycle progression.

  • Interplay with haploid-specific budding machinery: In haploid cells, the asymmetrically localized BUD8 is not sufficient to induce bipolar budding, due to the presence of haploid-specific budding proteins that override BUD8's function . This suggests a hierarchical organization of budding determinants.

How can advanced imaging techniques be used to study BUD8's role in cell polarity?

Advanced imaging techniques provide powerful tools for investigating BUD8's dynamic behavior and interactions within the cell polarity network:

  • Time-lapse fluorescence microscopy: This approach enables real-time visualization of BUD8-GFP localization during cell division, providing insights into the dynamics of BUD8 during the budding process .

  • Quantitative image analysis: Computational analysis of fluorescence intensity can be used to measure BUD8 concentration at different cellular locations and how this changes during the cell cycle or in response to environmental conditions.

  • Super-resolution microscopy: Techniques such as structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) can provide higher-resolution views of BUD8 localization that overcome the diffraction limit of conventional microscopy.

  • Fluorescence recovery after photobleaching (FRAP): This technique can be used to study the mobility and turnover of BUD8 at the distal pole, providing insights into the dynamics of this spatial landmark.

  • Multi-color imaging: Simultaneous visualization of BUD8 with other polarity factors (e.g., Bud2p, Bud5p, actin) can reveal spatial and temporal relationships between these components.

  • 3D reconstruction: Z-stack imaging and 3D reconstruction can provide a comprehensive view of BUD8 distribution throughout the cell volume, rather than just a single optical section.

These advanced imaging approaches, combined with genetic manipulations, can provide a more detailed understanding of how BUD8 contributes to the establishment and maintenance of cell polarity during budding.

How conserved is BUD8 function across different yeast species?

The conservation of BUD8 and its role in bud site selection across different yeast species provides insights into the evolution of cell polarity mechanisms:

A comprehensive evolutionary analysis would involve:

  • Sequence comparison of BUD8 homologs across yeast species

  • Functional complementation studies (e.g., can BUD8 from other species rescue S. cerevisiae bud8 mutants?)

  • Comparative analysis of protein localization patterns

  • Examination of expression regulation across species

What are the implications of BUD8 research for understanding other polarized cellular processes?

Research on BUD8 and bud site selection in yeast has broader implications for understanding polarized cellular processes in other organisms:

  • Model for spatial landmark proteins: BUD8 serves as a model for understanding how spatial landmarks are established and maintained in asymmetric cell division.

  • Insights into cell fate determination: The role of BUD8 in determining the site of budding provides insights into how spatial cues can influence cell fate decisions.

  • Relevance to other polarized processes: The mechanisms underlying BUD8 localization and function may have parallels in other polarized cellular processes, such as neuronal polarization or epithelial cell polarity.

  • Evolutionary perspective on cell polarity: Comparing BUD8 function across species can provide an evolutionary perspective on how cell polarity mechanisms have evolved.

  • Applications to synthetic biology: Understanding the modularity of BUD8 domains (as demonstrated by domain swapping experiments ) could inform synthetic biology approaches to engineer cellular polarity.

What are the current gaps in our understanding of BUD8 function?

Despite significant progress in understanding BUD8, several important questions remain unanswered:

  • Molecular mechanism of cortical tagging: The precise molecular mechanism by which BUD8 marks the distal pole and recruits the budding machinery remains incompletely understood.

  • Regulatory mechanisms: The factors that regulate BUD8 localization, especially during the transition from axial to unipolar-distal budding in haploid invasive growth, require further investigation.

  • Structure-function relationships: Detailed structural information about BUD8 domains and how they contribute to protein function is limited.

  • Interaction network: The complete set of proteins that interact with BUD8, either directly or indirectly, remains to be fully elucidated.

  • Connection to nutrient sensing: The mechanisms linking nutrient availability (e.g., glucose limitation) to changes in BUD8 function need further exploration.

What emerging technologies could advance BUD8 research?

Several emerging technologies and approaches hold promise for advancing our understanding of BUD8:

  • Cryo-electron microscopy: This could provide structural insights into BUD8 and its interactions with other proteins.

  • Single-molecule imaging: Techniques such as single-molecule tracking could reveal the dynamics of individual BUD8 molecules at the distal pole.

  • Proximity labeling approaches: Methods such as BioID or APEX could identify proteins in close proximity to BUD8 in living cells.

  • Optogenetic tools: These could be used to manipulate BUD8 localization or function with spatial and temporal precision.

  • CRISPR-based screening: Genome-wide CRISPR screens could identify additional factors involved in BUD8 function or regulation.

  • Systems biology approaches: Integration of multiple -omics datasets could provide a more comprehensive understanding of how BUD8 functions within the broader cellular network.

  • Microfluidics: Microfluidic devices that allow precise control of the cellular environment could be used to study how BUD8 responds to dynamic changes in nutrient availability.

These emerging technologies, combined with established genetic and cell biological approaches, have the potential to address the remaining questions about BUD8 function and its role in establishing cell polarity during budding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.