Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BUD9; YGR041W; G4152; Bud site selection protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-547
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
BUD9
Target Protein Sequence
MTKITRDVSITTENSKSTSGSATASSASLPENDHPIFHQPRARIRSGSLFIEGSDSFPSS EVKSYNVYIDDSKYSEILKGDTNSSSTDGKQVFEDARDDNFHQESHRDLEDSILDLVRRD PEVAAFPLPPPNSNERNRNSSNGSSAETNLNGHSSSGTISTSVLLNMGSAEKHAGTTRGD HMESSSMKSFEKLGTRPSSLFYPPPEGTAPYQGPRATVSGNKSTRQTQGTYSFPSMRYGV DLVSPVEGAVDVAKSRVPNSTLNGTFPDKAFIPHEFQIPKKAWNRIPANKSTSLKTPRNH SLLIDILKPFEAADLANDQRSSSAVLKNTVHSNGQYNPTNETSGTRMQDQRQKNTNEIDL EKIPNPQVPLGIAMDTMRSPNQLHEKEYESNIEAGLASGVGKGDNSIKQHQYKKIPQEID RDQQLSFQMETMPIQRIDSSSIRSFDSRIYGFSEIYSIPRVITTLCICLFVPPLFFFFSI NGNNGVSNYRLMRMIMNYEHRIGLLKGFEWDIDVQWFRTLCFVLGCIEMLAIFASIGIGF GVGIIRE
Uniprot No.

Target Background

Function
Potentially involved in the localization of the proximal bud pole signal.
Gene References Into Functions
  1. BUD9 is essential for random budding in each deletion mutant of EKC/KEOPS components. PMID: 21625000
Database Links

KEGG: sce:YGR041W

STRING: 4932.YGR041W

Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Found at the necks of large-budded cells and the proximal poles of daughter cells.

Q&A

What is the fundamental role of Bud9p in Saccharomyces cerevisiae?

Bud9p functions as a critical cortical landmark protein that regulates bud-site selection in diploid Saccharomyces cerevisiae. It primarily localizes at the proximal pole of the cell and is essential for establishing the bipolar budding pattern characteristic of diploid cells . In cellular architecture, Bud9p acts as a spatial inhibitor that fine-tunes bud site selection, as evidenced by the fact that deletion of BUD9 increases distal budding rather than creating a random pattern . This inhibitory function represents a sophisticated regulatory mechanism that helps maintain proper cell polarity across generations of yeast cells.

How does the localization of Bud9p differ between yeast form (YF) and pseudohyphal (PH) cells?

The localization pattern of Bud9p shows remarkable differentiation between yeast growth forms:

Cell FormBud9p LocalizationBudding PatternEffect of Nitrogen Status
Yeast Form (YF)Distal poleBipolarNormal localization under standard conditions
Pseudohyphal (PH)Absent from distal poleUnipolar distalNitrogen starvation prevents distal localization

In yeast form cells, Bud9p is localized at the distal pole, where it functions as an inhibitor of bud site selection. Interestingly, in pseudohyphal cells induced by nitrogen starvation, Bud9p fails to localize to the distal pole . This nutrient-responsive relocation mechanism explains why pseudohyphal cells exhibit a predominantly unipolar distal budding pattern, as the absence of the Bud9p inhibitor at the distal pole allows Bud8p to function unopposed as a landmark for bud initiation.

What is the relationship between Bud8p and Bud9p proteins?

Bud8p and Bud9p proteins have been demonstrated to physically associate in vivo through co-purification experiments. When glutathione S-transferase (GST)-tagged Bud9p was purified using glutathione beads, myc-tagged Bud8p co-purified with it but not with the GST control alone. Conversely, myc-tagged Bud9p associated with GST-Bud8p but not with the GST control . This physical interaction suggests a model where Bud8p serves as a positive landmark for bud initiation at the distal cell pole, while associated Bud9p functions as an inhibitor that modulates this activity. The dynamic balance between these two proteins is central to establishing proper budding patterns and can be shifted by environmental factors such as nitrogen availability.

How does the EKC/KEOPS complex regulate Bud9p localization?

The EKC/KEOPS complex (composed of Bud32p, Cgi121p, Gon7p, and other components) plays a crucial role in regulating the proper localization of Bud9p. Deletion mutants of EKC/KEOPS components (bud32Δ, cgi121Δ, and gon7Δ) exhibit random budding patterns in diploid cells, which can be suppressed by additional deletion of BUD9 . The relationship between EKC/KEOPS and Bud9p follows this molecular pathway:

  • The EKC/KEOPS complex acts downstream of the multigenerational proteins Rax1p/Rax2p.

  • The kinase activity of Bud32p, which is essential for EKC/KEOPS complex function, is required for bipolar bud-site selection.

  • In EKC/KEOPS deletion mutants, GFP-tagged Bud9p appears in dot-like structures at the cell periphery rather than in its normal asymmetric localization pattern .

Significantly, the stability and expression level of Bud9p remain unchanged in these mutants, indicating that the EKC/KEOPS complex specifically affects the spatial distribution of Bud9p after its delivery to the plasma membrane, rather than its expression timing or protein stability .

What experimental approaches are most effective for studying Bud9p localization in vivo?

To effectively study Bud9p localization in vivo, researchers should consider the following methodological approaches:

TechniqueApplicationKey Considerations
GFP-taggingDirect visualization of protein localizationN-terminal tagging preserves function better than C-terminal
Promoter swappingInvestigating timing effects on localizationBUD8 or CLB2 promoters allow G2/M phase expression
Co-immunoprecipitationDetecting protein-protein interactionsGST-tagging with myc-epitope partners effectively demonstrates associations
Genetic epistasis analysisDetermining pathway hierarchyDouble mutants with RAX2 and EKC/KEOPS components reveal upstream-downstream relationships

Researchers should be aware that GFP-Bud9p expression timing is critical, as expression from the BUD8 or CLB2 promoter (active in G2/M phase) rather than its native promoter (active in G1 phase) fails to properly localize the protein . Additionally, diploid homozygous deletion strains rather than point mutations or partial disruptions provide more definitive phenotypes for analysis of budding patterns .

How do mutations in the EKC/KEOPS complex components specifically affect Bud9p function?

Deletion of individual EKC/KEOPS complex components (bud32Δ, cgi121Δ, and gon7Δ) causes random budding patterns in diploid cells. These phenotypic effects can be specifically linked to Bud9p through the following observations:

  • BUD9 deletion in each EKC/KEOPS component mutant suppresses the random budding phenotype and increases distal pole budding .

  • The asymmetric localization of GFP-Bud9p is lost in EKC/KEOPS mutants, while GFP-Bud8p localization remains normal .

  • The stability and expression level of Bud9p protein remain unchanged in the mutants .

These data strongly suggest that mislocalization of Bud9p due to loss of EKC/KEOPS function is the primary cause of random budding in these mutants. Interestingly, the mutant phenotypes are not due to altered timing of BUD9 expression, as would be expected if random budding resulted from a transcriptional defect. Instead, the EKC/KEOPS complex appears to specifically regulate the spatial distribution of Bud9p after its delivery to the plasma membrane .

What are the most reliable techniques for visualizing Bud9p localization in different yeast cell types?

For reliable visualization of Bud9p localization across different yeast cell types, researchers should implement:

  • N-terminal GFP tagging: GFP-Bud9p fusion constructs expressed from native or controllable promoters provide direct visualization of protein localization in living cells. N-terminal tagging is preferable as it preserves the functionality of Bud9p .

  • Appropriate microscopy techniques:

    • Fluorescence microscopy for basic localization studies

    • Time-lapse microscopy to distinguish between unipolar proximal and unipolar distal budding patterns in real-time

    • Confocal microscopy for high-resolution analysis of co-localization with other proteins

  • Proper controls for comparative analysis:

    • Wild-type cells to establish baseline localization patterns

    • Analysis in both yeast form and pseudohyphal cells to observe nitrogen-responsive changes in localization

    • Parallel visualization of Bud8p to distinguish their potentially overlapping or distinct localization patterns

The choice of yeast strain background is also critical, as different strains may exhibit subtle variations in budding patterns. For definitive analysis, homozygous diploid strains carrying full deletions of genes of interest provide clearer phenotypes than strains with point mutations or partial disruptions .

How can researchers effectively study the interaction between Bud9p and the EKC/KEOPS complex?

To effectively study the interaction between Bud9p and the EKC/KEOPS complex, researchers should employ a multi-faceted approach:

  • Genetic interaction analysis:

    • Create double mutants combining bud9Δ with individual EKC/KEOPS component deletions (bud32Δ, cgi121Δ, gon7Δ)

    • Analyze budding patterns using bud scar staining to determine epistatic relationships

    • Include triple mutants with rax2Δ to establish the hierarchical order of the pathway

  • Biochemical interaction studies:

    • Co-immunoprecipitation experiments using epitope-tagged versions of Bud9p and EKC/KEOPS components

    • Yeast two-hybrid assays to test for direct protein-protein interactions

    • In vitro binding assays with recombinant proteins to confirm direct interactions

  • Localization dependence analysis:

    • Express GFP-Bud9p in wild-type and EKC/KEOPS mutant backgrounds

    • Quantify the distribution patterns of fluorescent signals across multiple cells

    • Compare protein expression levels via western blot analysis to ensure observed effects are not due to changes in protein abundance

This integrated approach has successfully demonstrated that the EKC/KEOPS complex specifically regulates Bud9p localization downstream of Rax1p/Rax2p, while not affecting Bud8p or Rax2p localization .

What are the optimal conditions for studying nitrogen-dependent changes in Bud9p localization?

To study nitrogen-dependent changes in Bud9p localization, researchers should establish the following experimental conditions:

Condition TypeYeast Form (YF)Pseudohyphal (PH) Induction
Media CompositionComplete media with normal nitrogen levelsLow-ammonium SLAD media (50 μM ammonium sulfate)
Cell DensityMid-log phase (OD600 0.6-0.8)Low initial density for monitoring filament development
Strain BackgroundDiploid Σ1278b background preferredDiploid Σ1278b background (competent for PH formation)
Incubation Time4-6 hours for standard growth3-5 days for full PH development
Temperature30°C optimal30°C optimal

When designing such experiments, it's crucial to:

  • Use appropriate genetic markers to track Bud9p. GFP-Bud9p expressed from its native promoter provides the most physiologically relevant localization pattern .

  • Include careful controls:

    • Wild-type cells expressing GFP-Bud9p in both nitrogen-rich and nitrogen-limiting conditions

    • Parallel tracking of Bud8p localization to compare responses

    • Non-filamentous control strains to differentiate general starvation responses from PH-specific effects

  • Time-course analysis:

    • Monitor localization changes at regular intervals after nitrogen limitation

    • Correlate protein localization changes with the progression of morphological changes in pseudohyphal development

These techniques have revealed that nitrogen starvation efficiently prevents distal localization of Bud9p in pseudohyphal cells, providing a mechanistic explanation for the switch from bipolar to unipolar distal budding during the transition from yeast form to pseudohyphal growth .

What is the significance of the physical association between Bud8p and Bud9p for bud site selection?

The physical association between Bud8p and Bud9p represents a sophisticated molecular mechanism for fine-tuning bud site selection:

  • Balanced regulation: The interaction creates a system where the positive landmark function of Bud8p at the distal pole can be modulated by the inhibitory effect of Bud9p . This balance allows for precise control over budding frequency at specific cellular locations.

  • Integration point for environmental signals: The association provides a platform where multiple signaling inputs, such as nutritional status, can converge to modulate budding patterns. Under nitrogen starvation, the failure of Bud9p to localize to the distal pole alters this balance, favoring Bud8p-mediated distal budding .

  • Molecular switch mechanism: The interaction potentially functions as a molecular switch that can rapidly toggle between alternative budding patterns without requiring extensive changes in protein expression. This provides a responsive system for adapting to changing environmental conditions.

  • Evolutionary significance: The sophisticated interaction between these proteins may represent an evolved mechanism that allows yeast to optimize resource allocation and survival strategies under different environmental conditions.

The Bud8p-Bud9p interaction has been experimentally validated through co-immunoprecipitation experiments, where myc-Bud8p co-purifies with GST-Bud9p (but not with GST alone), and conversely, myc-Bud9p associates with GST-Bud8p (but not with GST control) . This physical evidence supports a model where these proteins work in concert to establish proper budding patterns.

What are the most promising approaches for identifying the molecular mechanisms by which the EKC/KEOPS complex regulates Bud9p?

Future research into how the EKC/KEOPS complex regulates Bud9p should focus on:

  • Post-translational modification analysis:

    • Investigate whether Bud32p kinase directly phosphorylates Bud9p using in vitro kinase assays

    • Perform mass spectrometry analysis to identify specific phosphorylation sites or other modifications on Bud9p

    • Create phosphomimetic and phosphodeficient mutants of Bud9p to test functional consequences

  • Structural biology approaches:

    • Determine the structure of Bud9p, particularly its transmembrane and cytoplasmic domains

    • Investigate structural interactions between Bud9p and EKC/KEOPS components

    • Use FRET-based approaches to visualize these interactions in living cells

  • Interactome mapping:

    • Perform systematic proteomic analysis of Bud9p interactors in wild-type versus EKC/KEOPS mutant backgrounds

    • Use BioID or proximity labeling techniques to identify proteins that transiently interact with Bud9p

    • Develop split-GFP systems to visualize where in the cell these interactions occur

  • Single-molecule tracking:

    • Implement advanced imaging techniques to track the movement and localization of individual Bud9p molecules

    • Compare diffusion rates and membrane dynamics between wild-type and EKC/KEOPS mutant cells

These approaches would help elucidate whether the EKC/KEOPS complex regulates Bud9p through direct modification, through effects on its binding partners, or by influencing membrane domain organization at the cell cortex.

How might advanced imaging techniques contribute to our understanding of Bud9p dynamics during the cell cycle?

Advanced imaging techniques could significantly enhance our understanding of Bud9p dynamics through:

  • Super-resolution microscopy:

    • Techniques like STORM, PALM, or STED could resolve Bud9p distribution at nanometer-scale resolution

    • This would reveal potential microdomains or clusters not visible with conventional microscopy

    • Could distinguish between different populations of Bud9p at various cell locations

  • Light-sheet microscopy:

    • Allows long-term imaging with minimal phototoxicity

    • Would enable tracking of Bud9p throughout multiple cell cycles

    • Could reveal how Bud9p is inherited and redistributed during budding events

  • Correlative light and electron microscopy (CLEM):

    • Would connect Bud9p fluorescence signals with ultrastructural features

    • Could identify specific membrane domains or cortical structures where Bud9p accumulates

  • Optogenetic approaches:

    • Development of light-activatable Bud9p variants to manipulate its function in real-time

    • Would allow testing of acute versus chronic effects of Bud9p mislocalization

  • Fluorescence fluctuation spectroscopy:

    • Techniques like Number and Brightness analysis could measure Bud9p oligomerization state

    • Fluorescence Correlation Spectroscopy could determine diffusion rates in different cellular regions

These approaches would help address key questions about Bud9p inheritance across cell divisions, its temporal regulation throughout the cell cycle, and how it interacts with membrane domains and the cytoskeleton to establish and maintain cell polarity.

What are the potential connections between Bud9p function and other cellular processes beyond bud site selection?

Emerging evidence suggests Bud9p function may extend beyond budding pattern regulation to influence:

  • Cell cycle progression and checkpoint control:

    • The timing of BUD9 expression in G1 phase suggests potential coordination with cell cycle events

    • Investigation of checkpoint activation in bud9Δ mutants could reveal connections to cell cycle surveillance mechanisms

  • Stress response pathways:

    • The nitrogen-responsive regulation of Bud9p localization indicates integration with nutrient sensing pathways

    • Systematic analysis of Bud9p localization under various stress conditions could uncover broader stress-responsive functions

  • Cellular aging and lifespan:

    • The EKC/KEOPS complex has roles in telomere maintenance , suggesting potential connections to aging

    • Analysis of replicative lifespan in bud9Δ mutants could reveal roles in age-associated phenotypes

  • Protein quality control:

    • The specific mislocalization of Bud9p in EKC/KEOPS mutants raises questions about targeted protein trafficking

    • Investigation of Bud9p interactions with the cytoskeleton and membrane trafficking machinery could reveal broader roles in protein localization

  • Intercellular communication:

    • The role of Bud9p in regulating cell morphology and division patterns may influence colony architecture

    • Examination of biofilm formation and other multicellular behaviors in bud9Δ mutants could reveal community-level functions

These potential connections highlight how a protein initially characterized for a specific morphogenetic function might participate in integrating multiple cellular processes to coordinate growth, division, and adaptation to environmental changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.