Recombinant Saccharomyces cerevisiae C-5 sterol desaturase (ERG3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ERG3; PSO6; SYR1; YLR056W; L2150; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERG3
Target Protein Sequence
MDLVLEVADHYVLDDLYAKVLPASLAANIPVKWQKLLGLNSGFSNSTILQETLNSKNAVK ECRRFYGQVPFLFDMSTTSFASLLPRSSILREFLSLWVIVTIFGLLLYLFTASLSYVFVF DKSIFNHPRYLKNQMAMEIKLAVSAIPWMSMLTVPWFVMELNGHSKLYMKIDYENHGVRK LIIEYFTFIFFTDCGVYLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQSI SYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYG QFTTLWDRLGGSYRRPDDSLFDPKLRDAKETWDAQVKEVEHFIKEVEGDDNDRIYENDPN TKKNN
Uniprot No.

Target Background

Function
This recombinant *Saccharomyces cerevisiae* C-5 sterol desaturase (ERG3) catalyzes the introduction of a C-5 double bond into the B ring of ergosterol. It may play a role in regulating ergosterol biosynthesis.
Database Links

KEGG: sce:YLR056W

STRING: 4932.YLR056W

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and basic function of ERG3 in Saccharomyces cerevisiae?

ERG3 is the structural gene in Saccharomyces cerevisiae that encodes sterol delta 5 desaturase, which catalyzes the introduction of C5=6 unsaturation during ergosterol biosynthesis. The gene has been mapped to chromosome XII, specifically 13.7 centimorgans from GAL2 toward SPT8 . The enzyme it encodes is classified as a C-5 sterol desaturase (also known as sterol C-5 desaturase or C5SD) and is highly conserved across eukaryotic organisms . In the ergosterol biosynthetic pathway of S. cerevisiae, this enzyme specifically oxidizes episterol, whereas its ortholog in humans (lathosterol oxidase) oxidizes lathosterol during cholesterol synthesis .

How does the mechanism of C-5 sterol desaturase function at the molecular level?

The C-5 sterol desaturase in S. cerevisiae functions through a coupled redox reaction that joins sterol oxidation with both NAD(P)H oxidation and molecular oxygen reduction. The enzyme can utilize either NADH or NADPH as a cofactor with relatively little preference between the two, unlike its counterpart in Arabidopsis thaliana which shows a twofold higher reaction rate with NADH .

Mechanistically, the enzyme contains a conserved cluster of histidine residues that are critical for catalytic activity. Mutagenesis studies in related organisms have demonstrated that alterations to these conserved histidines dramatically reduce or eliminate enzyme function, strongly suggesting the involvement of a coordinated iron cation in the catalytic mechanism . The proposed reaction mechanism involves an iron-coordinated oxygen abstracting a hydrogen from the sterol substrate, which leads to the formation of a radical intermediate .

What growth conditions affect ERG3 essentiality in S. cerevisiae?

The essentiality of the ERG3 gene depends critically on the cultivation conditions employed. Insertionally inactivated ERG3 mutants exhibit specific growth defects, particularly failing to grow in the absence of 'sparking' levels of delta 5 sterols when cells are heme-deficient . Additionally, these mutants are unable to grow on respiratory substrates such as glycerol and ethanol . This conditional essentiality highlights the metabolic flexibility of yeast and the interconnection between sterol biosynthesis and respiratory metabolism, factors that must be carefully considered when designing experiments with ERG3 mutants.

How can researchers effectively create and validate recombinant ERG3 constructs?

To create recombinant ERG3 constructs, researchers should first amplify the ERG3 open reading frame using carefully designed primers. Based on published methodologies, primers can be designed to target the full ERG3 sequence (e.g., 5′-ATGGATATCGTACTAGAAATTTGTG-3′ for the forward primer and 5′-GCTGGGAAAAATTTAGGAGC-3′ for the reverse primer) . The amplified product should then be inserted into an appropriate expression vector.

For validation, multiple approaches should be employed:

  • PCR verification with vector-specific and ERG3-specific primers to confirm correct orientation of the insert

  • Southern blot analysis to verify genomic integration (if applicable), using a probe derived from the ERG3 ORF

  • Northern blot analysis to confirm transcriptional activity

  • qRT-PCR to quantify expression levels, using an internal control gene such as ACT1 to normalize RNA amounts

  • Gas chromatography-mass spectrometry (GC-MS) sterol analysis to confirm functional enzyme activity through detection of pathway-specific sterols

Validation should include comparative analysis with wild-type strains to ensure the recombinant construct produces a functional enzyme.

What are the implications of amino acid substitutions in ERG3 for enzyme function and phenotype?

Amino acid substitutions in ERG3 can significantly alter enzyme function and produce distinct phenotypes. Clinical isolates of Candida albicans with ERG3 mutations have revealed several recurring substitutions, including T330A and A351V, as well as single-residue changes such as W332R that correlate with altered sterol profiles . These mutations can result in:

  • Complete loss of Erg3p activity, resulting in the absence of ergosterol production

  • "Leaky" mutations that reduce but do not eliminate enzyme function, resulting in decreased ergosterol levels

  • Changes in azole drug susceptibility, often manifesting as resistance

When studying recombinant ERG3 in S. cerevisiae, it's important to consider that even single amino acid substitutions in conserved regions can dramatically alter enzyme function. Particularly, mutations in the conserved histidine cluster are likely to affect iron coordination and catalytic activity . Researchers should employ site-directed mutagenesis to study specific residues and utilize GC-MS sterol analysis to characterize the functional impact of these substitutions.

How do ERG3 mutations affect cellular responses to azole antifungals?

ERG3 mutations can significantly alter cellular responses to azole antifungals, with several clinically isolated erg3 mutants displaying azole resistance . This occurs through a complex mechanism:

  • Azole drugs typically target Erg11p (lanosterol 14α-demethylase), causing accumulation of toxic 14α-methylated sterols

  • Functional Erg3p normally converts these intermediates to the toxic sterol 14α-methyl-3,6-diol

  • In erg3 mutants, this conversion is prevented, allowing alternative, non-toxic sterols to be produced

This mechanism explains why erg3 mutants with complete loss of function or specific "leaky" mutations can survive azole treatment. When designing experiments to study azole resistance, researchers should:

  • Perform comprehensive sterol profiling using GC-MS to confirm altered sterol composition

  • Sequence both ERG3 and ERG11 genes, as mutations in both can contribute to resistance

  • Conduct susceptibility testing across multiple azole drugs to characterize the resistance profile

  • Consider that clinically relevant erg3 mutants may be more prevalent than currently recognized

What strain selection criteria should be applied when studying recombinant ERG3 in S. cerevisiae?

Strain selection is critical when studying recombinant ERG3. Based on comparative analysis of industrial and laboratory strains, significant variations exist in basal ergosterol levels and growth characteristics that can impact experimental outcomes. For example, industrial diploid yeast strains such as CICC1746 (S1) demonstrate significantly higher ergosterol content (7.8 ± 0.2 mg/g dry cell weight) compared to laboratory strains like BY4741 (3.4 ± 0.2 mg/g DCW) .

When selecting a strain for recombinant ERG3 studies, researchers should consider:

  • Basal ergosterol content - higher initial levels may provide advantages for certain studies

  • Growth characteristics - industrial strains typically achieve higher cell densities (OD600 ~28 vs ~14 for lab strains)

  • Genetic background - particularly regarding other ergosterol biosynthesis genes

  • Auxotrophic markers - ensure compatibility with planned selection methods

  • Ploidy - diploid strains may exhibit different ERG3 regulation than haploid strains

For metabolic engineering studies specifically targeting ergosterol production, industrial strains with naturally higher ergosterol content represent potentially superior starting points .

What methods enable accurate quantification of ERG3 expression and activity?

Accurate quantification of ERG3 expression and activity requires a multi-method approach:

  • Transcriptional Analysis:

    • qRT-PCR using gene-specific primers and appropriate reference genes (e.g., ACT1)

    • Northern blot analysis for qualitative confirmation of transcript size and abundance

  • Protein Expression:

    • Western blot analysis with ERG3-specific antibodies

    • Epitope tagging of recombinant ERG3 (e.g., HA, FLAG) for detection with commercial antibodies

  • Enzyme Activity:

    • GC-MS sterol profiling to quantify pathway intermediates and products

    • In vitro enzyme assays measuring NAD(P)H oxidation rates

    • Oxygen consumption measurements during the desaturation reaction

  • Phenotypic Characterization:

    • Growth assays under respiratory conditions (glycerol/ethanol media)

    • Azole susceptibility testing

    • Microscopic examination of cellular morphology

For comprehensive quantification, researchers should employ at least one method from each category to correlate gene expression with enzyme activity and resulting phenotypes.

What strategies can optimize heterologous ERG3 expression in S. cerevisiae?

Optimizing heterologous ERG3 expression requires careful consideration of several key factors:

  • Promoter Selection:

    • For constitutive expression: strong promoters like TDH3 or TEF1

    • For inducible expression: GAL1 or CUP1 promoters

    • For dynamic regulation: auto-inducible promoters that respond to growth phase can prevent premature ergosterol accumulation that might inhibit growth

  • Codon Optimization:

    • Adjust codon usage to match S. cerevisiae preferences, particularly for heterologous ERG3 genes

    • Remove rare codons that might limit translation efficiency

  • Integration Location:

    • Target genomic loci known for stable expression (e.g., delta sequences)

    • Consider multiplex integration for increased gene dosage

  • Strain Engineering:

    • Overexpress transcription factors that regulate ergosterol biosynthesis (e.g., UPC2-1)

    • Enhance storage capacity through expression of sterol acyltransferases like ARE2

    • Increase fatty acid biosynthesis (e.g., ACC1 overexpression) to expand storage pools for ergosterol

  • Cultivation Conditions:

    • Implement two-stage feeding strategies for high-density fermentation

    • Monitor and maintain optimal dissolved oxygen levels for enzyme activity

    • Consider temperature modulation to balance growth and expression

How should researchers analyze and interpret sterol profiles in ERG3 mutants?

Sterol profile analysis in ERG3 mutants presents several challenges requiring careful methodological approaches:

  • Sample Preparation:

    • Total sterol extraction should use saponification followed by organic solvent extraction

    • Free sterols and steryl esters should be analyzed separately to understand storage dynamics

    • Internal standards must be carefully selected to match the chemical properties of target sterols

  • Analytical Techniques:

    • GC-MS represents the gold standard for comprehensive sterol profiling

    • HPLC can provide complementary data, particularly for thermally labile intermediates

    • NMR spectroscopy can confirm novel sterol structures when reference standards are unavailable

  • Data Interpretation Challenges:

    • Distinguishing partial ("leaky") from complete loss-of-function mutations

    • Accounting for compensatory changes in other ergosterol pathway genes

    • Recognizing novel sterol intermediates that may accumulate in mutants

  • Comparative Analysis:

    • Always include appropriate wild-type controls processed identically

    • Consider both sterol composition (relative percentages) and absolute quantification

    • Correlate sterol profiles with phenotypic observations

Particular attention should be paid to the accumulation of specific intermediates that indicate the precise point of pathway disruption, such as episterol accumulation indicating ERG3 dysfunction.

What are the key considerations when analyzing ERG3 mutations and their functional effects?

When analyzing ERG3 mutations and their functional effects, researchers should consider:

  • Mutation Classification:

    • Null mutations causing complete loss of function

    • Hypomorphic ("leaky") mutations with partial activity

    • Gain-of-function mutations (rare but possible)

    • Regulatory region mutations affecting expression levels

  • Structural Analysis:

    • Map mutations onto predicted protein structure

    • Assess conservation of affected residues across species

    • Consider proximity to active sites or cofactor binding regions

    • Evaluate impact on protein stability using computational tools

  • Phenotypic Correlation:

    • Growth characteristics under different carbon sources

    • Respiratory competence

    • Sterol profiles and ergosterol content

    • Azole susceptibility patterns

  • Genetic Interactions:

    • Analyze interactions with other ergosterol pathway genes (e.g., ERG11)

    • Consider epistatic effects in double mutants

    • Evaluate suppressors and synthetic lethal interactions

Several recurring mutations in clinical isolates (T330A, A351V, W332R) provide valuable reference points for functional effects . Researchers should systematically characterize new mutations against these known variants to build a comprehensive understanding of structure-function relationships.

How can metabolic engineering approaches enhance ergosterol production using recombinant ERG3?

Metabolic engineering offers several strategies to enhance ergosterol production through ERG3 modification and pathway engineering:

  • Push-Pull Strategy:

    • Increasing flux into the ergosterol pathway ("push")

    • Enhancing conversion of intermediates to final product ("pull")

    • Overexpression of rate-limiting enzymes including ERG3

  • Storage Expansion:

    • Overexpression of sterol acyltransferase ARE2 to convert ergosterol to steryl esters (increased content from 7.8 to 10 mg/g DCW)

    • Enhancement of fatty acid biosynthesis through ACC1 overexpression to expand lipid droplet capacity (further increased to 20.7 mg/g DCW)

  • Regulatory Modification:

    • Overexpression of global regulatory factor UPC2-1 (increased content to 16.7 mg/g DCW)

    • Implementation of dynamic regulation using auto-inducible promoters to control expression timing (resulting in 40.6 mg/g DCW, 4.2-fold higher than starting strain)

  • Cultivation Optimization:

    • Development of two-stage feeding strategies for high-density fermentation (achieving 2986.7 mg/L and 29.5 mg/g DCW)

  • Systems Biology Approach:

    • Integration of multi-omics data to identify non-obvious targets for intervention

    • Modeling of sterol metabolism to predict optimal engineering strategies

These approaches can be combined for synergistic effects, with published results demonstrating that comprehensive pathway engineering can increase ergosterol content more than 4-fold compared to wild-type strains .

What potential applications exist for ERG3 variants with altered substrate specificities?

ERG3 variants with altered substrate specificities offer several promising research applications:

  • Novel Sterol Production:

    • Engineering ERG3 to accept non-native substrates could enable production of pharmaceutically relevant sterols

    • Creation of hybrid sterols with properties intermediate between ergosterol and cholesterol

  • Drug Development Platform:

    • ERG3 variants could produce novel substrates for testing antifungal compounds

    • Screening libraries of ERG3 mutants against azole drugs could identify resistance mechanisms

  • Metabolic Pathway Engineering:

    • ERG3 variants might enable creation of synthetic sterol biosynthetic pathways

    • Redirection of flux toward production of specific intermediates with commercial value

  • Evolutionary Studies:

    • Engineered ERG3 variants could test hypotheses about sterol desaturase evolution

    • Recreation of ancestral enzymes to understand evolutionary trajectories

  • Structure-Function Studies:

    • Systematic mutagenesis combined with activity assays could map the enzyme's active site

    • Identification of residues controlling substrate specificity vs. catalytic activity

The divergent substrate preferences between human (lathosterol) and yeast (episterol) C-5 sterol desaturases provide a natural starting point for exploring the molecular determinants of substrate specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.