Recombinant Saccharomyces cerevisiae CAAX prenyl protease 1 (STE24)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Substrate Specificity

Ste24p, encoded by the STE24/AFC1 gene, exhibits dual protease and metalloendopeptidase activities. It cleaves the -AAX residues from prenylated CAAX motifs (e.g., a-factor’s CVIA) and also processes non-CAAX substrates like the N-terminal extension of a-factor . Key findings include:

  • Substrate Overlap: Ste24p shares partially overlapping specificity with Rce1p, another CAAX protease. For example:

    • Ste24p preferentially cleaves CASQ motifs in a-factor reporters .

    • Both proteases process CVIA and CAMQ motifs but with varying efficiency .

  • Context-Dependent Activity: Ste24p’s efficiency depends on structural context. For instance, the CTQQ motif in Trypanosoma brucei Hsp40 is cleaved in its native context but not when fused to yeast a-factor .

Substrate MotifSte24p ActivityRce1p ActivitySource
CVIA (yeast a-factor)YesYes
CASQYes (preferred)No
CTLMNoYes

Inhibitor Sensitivity and Mutational Analysis

Ste24p is a zinc metalloprotease sensitive to specific inhibitors and metal ions :

  • Inhibitors:

    • Strong inhibition by TPCK (tosyl phenylalanyl chloromethyl ketone) .

    • Weak inhibition by EDTA and EGTA, unlike Rce1p .

  • Critical Residues: Site-directed mutagenesis identified essential amino acids for catalysis:

    • H194, E156, C251, and H248 are indispensable for activity .

Inhibitor/ModulatorEffect on Ste24pEffect on Rce1p
TPCKStrong inhibitionStrong inhibition
EDTAWeak inhibitionNo effect
Zn²⁺InhibitoryInhibitory

Subcellular Localization and Recombinant Production

Ste24p is an endoplasmic reticulum (ER)-membrane protein with six transmembrane domains . Recombinant forms are produced in heterologous systems like E. coli, yeast, and baculovirus :

  • Expression Systems:

    • S. cerevisiae: High-copy plasmids under the constitutive PGK1 promoter enhance yield .

    • Commercial kits express full-length Ste24p (1-453 aa) with tags (e.g., His, GST) for purification .

  • Localization Studies:

    • Native Ste24p localizes to the ER membrane, but epitope-tagged variants (HA, myc) mislocalize to the Golgi, affecting function .

Evolutionary and Functional Conservation

Ste24p homologs exist across eukaryotes, including Schizosaccharomyces pombe (mam4p) and Arabidopsis thaliana (FACE1), which complement yeast Δste14 mutants . This conservation underscores its fundamental role in CAAX processing.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate this to us, and we will prioritize development of the specified tag.
Synonyms
STE24; AFC1; YJR117W; J2032; CAAX prenyl protease 1; A-factor-converting enzyme; Prenyl protein-specific endoprotease 1; PPSEP 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
STE24
Target Protein Sequence
MFDLKTILDHPNIPWKLIISGFSIAQFSFESYLTYRQYQKLSETKLPPVLEDEIDDETFH KSRNYSRAKAKFSIFGDVYNLAQKLVFIKYDLFPKIWHMAVSLLNAVLPVRFHMVSTVAQ SLCFLGLLSSLSTLVDLPLSYYSHFVLEEKFGFNKLTVQLWITDMIKSLTLAYAIGGPIL YLFLKIFDKFPTDFLWYIMVFLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLA DRVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNSNSTDEITAVLAHEIG HWQKNHIVNMVIFSQLHTFLIFSLFTSIYRNTSFYNTFGFFLEKSTGSFVDPVITKEFPI IIGFMLFNDLLTPLECAMQFVMSLISRTHEYQADAYAKKLGYKQNLCRALIDLQIKNLST MNVDPLYSSYHYSHPTLAERLTALDYVSEKKKN
Uniprot No.

Target Background

Function
This protease specifically removes the C-terminal three residues of farnesylated A-factor mating pheromone. It also cleaves the N-terminal extension of the pheromone. Importantly, it does not act on Ras.
Gene References Into Functions
  1. It appears that the very nature of signal recognition particle (SRP)-independent translocation makes it susceptible to unique challenges such as clogging. Upon clogging, Ste24 is recruited to the translocon, likely with other factors. There, Ste24 proceeds to cleave the clogged protein, resolving the impasse and salvaging the translocon. PMID: 26771486
  2. The crystal structure of the CAAX protease Ste24p, a zinc metalloprotease catalyzing two proteolytic steps in the maturation of yeast mating pheromone a-factor, has been determined. PMID: 23539602
Database Links

KEGG: sce:YJR117W

STRING: 4932.YJR117W

Protein Families
Peptidase M48A family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is STE24 and what are its primary cellular functions?

STE24 is a zinc metalloprotease from Saccharomyces cerevisiae that performs multiple essential cellular functions. Primarily, it participates in CAAX processing, a series of posttranslational modifications of proteins containing a C-terminal CAAX motif (where C is cysteine, A is an aliphatic amino acid, and X is one of several amino acids) . STE24 functions as a CAAX protease that cleaves the last three amino acids (AAX) following protein isoprenylation . Additionally, STE24 plays a critical role in translocon quality control by clearing clogged translocons, particularly those involved in posttranslational translocation (PTT) . This protease is unique in that it recognizes only isoprenylated substrates and can perform two distinct cleavage reactions sequentially at structurally unrelated sites in the same substrate molecule, notably the mating pheromone a-factor in yeast . The deletion of STE24 generates notable endoplasmic reticulum (ER) stress and interferes with membrane protein topology, indicating its importance in maintaining cellular homeostasis .

What is the structural organization of STE24?

STE24 possesses a distinctive structural organization that defines a novel class of membrane proteases. X-ray crystallography has revealed that STE24 contains 7 transmembrane helices that form a voluminous water-filled intramembrane barrel-shaped chamber that is capped at both ends . Notably, the metalloprotease active site faces the chamber interior, creating a protected catalytic environment. This arrangement restricts substrate entry and exit, which must occur through one of four side portals in the protein . This unique structure does not resemble any other class of intramembrane proteases described to date, highlighting STE24's distinct evolutionary origin and mechanism. The intramembrane chamber appears to be critical for STE24's function, potentially allowing it to interact with both soluble domains and membrane-embedded regions of substrate proteins.

Where is STE24 localized within the cell?

STE24 is primarily localized to the endoplasmic reticulum (ER) membrane in Saccharomyces cerevisiae. Subcellular fractionation and immunofluorescence studies have confirmed this localization . Interestingly, the insertion of epitope tags at various positions (N-terminus, C-terminus, or internal sites) can disrupt this localization, causing STE24 to be mislocalized to the Golgi apparatus . The CAAX proteases, including STE24, are ER membrane proteins, indicating that the intracellular site of CAAX protein processing is the ER membrane, presumably on its cytosolic face . This localization is functionally important, as it positions STE24 where it can access both newly synthesized proteins requiring CAAX processing and translocons that may become clogged during protein translocation.

How does STE24 contribute to translocon quality control?

STE24 plays a crucial role in resolving faulty translocational states, particularly translocon clogging. Translocons are molecular channels that allow proteins to cross membranes in a process called translocation, enabling proteins to reach their appropriate cellular locations . When translocation fails, substrate proteins can become stuck and obstruct the translocon pore, a state known as translocon clogging . Research has demonstrated that STE24 approaches the translocon upon clogging, interacts with the clogged protein, and generates cleavage fragments to clear the obstruction .

Specifically, STE24 has been shown to be critical for resolving clogging in the posttranslational translocation (PTT) pathway. In cells lacking STE24 (Δste24), there are highly elevated amounts of clogged proteins and significant amounts of cytosolic forms of clogging-prone proteins, indicating a blockage in translocation . Furthermore, inducing clogger proteins in Δste24 cells attenuates the ER entry of endogenous SRP-independent substrates such as Gas1 and Pdi1, as well as Kar2, which can utilize both SRP-dependent and independent pathways . Importantly, this function is specific to the SRP-independent pathway, as STE24 does not affect SRP-dependent translocation or degrade proteins that undergo cotranslational translocation (CTT) .

What is the mechanism of substrate binding and recognition by STE24?

STE24's substrate recognition mechanism is highly specific, recognizing only isoprenylated substrates . The enzyme's unique barrel-shaped chamber contains the metalloprotease active site facing the interior, with substrate entry and exit occurring through side portals . Research using photoactivatable analogs of a-factor containing biotin moieties has identified regions important for substrate binding. Preliminary results suggest that the substrate binding site for isoprenylated a-factor in STE24 is in a region surrounding the active site, lying between two portal sites within the chamber .

Site-directed mutagenesis studies coupled with radioactive methyltransferase-protease assays have been employed to characterize the functional importance of specific residues in substrate binding . The unique architecture of STE24 likely facilitates the sequential cleavage reactions it performs at structurally unrelated sites in the same substrate molecule. The water-filled chamber may provide a specialized environment that positions substrates correctly for proteolysis while sequestering hydrophobic moieties like the isoprenyl group.

What is the relationship between STE24 and other CAAX processing enzymes?

STE24 functions as part of a sequential processing pathway for CAAX proteins in Saccharomyces cerevisiae. In this pathway, the first modification is isoprenylation, mediated by the Ram1p/Ram2p farnesyltransferase or the Ram2p/Cdc43p geranylgeranyltransferase . Following isoprenylation, proteolytic cleavage of the last three amino acids (AAX) is performed by Rce1p and/or STE24/Afc1p . Finally, the prenylated protein from which the AAX tripeptide has been removed is carboxylmethylated by the prenylcysteine carboxyl methyltransferase Ste14p .

Importantly, STE24's role in clearing clogged translocons is distinct from its CAAX processing function. The absence of other CAAX processing factors such as Ram1 or Axl1 does not affect translocon clogging, and CAAX processing mutants (Δrce1 and Δaxl1) do not exhibit growth defects with clogger proteins . This indicates that STE24's role in translocon quality control is independent of its role in CAAX processing. Furthermore, the metalloprotease activity of STE24 is specifically required for its unclogging function, suggesting direct proteolytic action on clogged substrates .

What methods are used to assess STE24 protease activity?

Several methodological approaches have been developed to assess STE24 protease activity in research settings. One primary method is the radioactive coupled methyltransferase-protease assay, which allows for the quantification of STE24's proteolytic activity . This assay takes advantage of the sequential nature of CAAX processing, where proteolysis by STE24 precedes methylation.

For studying STE24's role in translocon clogging, researchers have employed growth assays that measure the impact of clogging on cellular fitness. Both solid media growth assays and more precise liquid-growth measurements have been used to demonstrate that loss of STE24 is detrimental to cells expressing clogger proteins . Direct assessment of clogging involves analyzing the accumulation of clogged proteins using western blot analysis . Additionally, the impact of STE24 on translocation can be measured by monitoring the ER entry of various substrates in the presence and absence of STE24 .

In vitro insertion assays using microsomes derived from either wild-type or Δste24 cells have been employed to test whether STE24 affects the functionality of the SRP-independent translocon. These assays use substrates like prepro-alpha-factor (ppαF) to assess translocation efficiency .

How can researchers generate and analyze STE24 mutants?

Site-directed mutagenesis is a primary method for generating mutant forms of STE24 to study structure-function relationships . This approach allows researchers to target specific residues predicted to be important for substrate binding, catalysis, or structural integrity. The resulting mutants can be characterized for protease activity using the radioactive coupled methyltransferase-protease assay described above .

For studying substrate binding, photoactivatable analogs of substrate proteins (such as a-factor) containing biotin moieties can be used. Substrate binding can then be assessed by immunoblot analysis using Neutravidin-HRP . To accurately identify amino acids in or near the binding site, tandem MS/MS methods can be developed. These techniques allow researchers to identify labeled amino acids in proteins that have been cross-linked to photoactivatable substrate analogs .

The introduction of epitope tags should be approached with caution, as research has shown that inserting hemagglutinin epitope tags at the N terminus, C terminus, or at an internal site can disrupt the ER localization of STE24 and result in its mislocalization to the Golgi .

What approaches can be used to study STE24's role in translocon clogging?

To study STE24's role in translocon clogging, researchers have developed several specialized approaches. One strategy involves engineering proteins specifically designed to clog translocons . These "clogger" constructs can be expressed in yeast strains with or without STE24, and their abundance can be analyzed via western blot analysis to determine if STE24 promotes their degradation .

The impact of clogging on cellular processes can be assessed by monitoring the translocation of endogenous substrates. For instance, researchers have examined how inducing clogger proteins in Δste24 cells affects the ER entry of endogenous SRP-independent substrates (Gas1, Pdi1) and substrates that can use both pathways (Kar2) .

Fluorescence microscopy with fusion proteins (such as RFP-Gas1 or Hxt2-GFP) can be used to visualize the localization of proteins in the presence or absence of STE24. This approach has revealed that RFP-Gas1, which is normally localized to the cell periphery, is additionally found on the ER in Δste24 cells, indicating clogging or attenuated ER entry .

How conserved is STE24 across different species?

STE24 is remarkably conserved across different eukaryotic species, from yeast to mammals. The human homologue of yeast STE24 is ZMPSTE24, which performs similar functions in translocon quality control . Studies have demonstrated that the function of STE24 in clearing clogged translocons is conserved in ZMPSTE24, highlighting the evolutionary importance of this process . Interestingly, disease-associated mutant forms of ZMPSTE24 fail to clear the translocon, suggesting a potential mechanistic link between translocon clogging and certain human diseases .

The STE24 homologue from Schizosaccharomyces pombe, called mam4p, has been shown to complement a Δste24 mutant in Saccharomyces cerevisiae, further demonstrating the functional conservation across species . This cross-species complementation, along with additional examples, indicates that the CAAX methyltransferase family consists of functional homologues that have maintained their critical roles throughout evolution .

What are the implications of STE24 dysfunction in cellular pathology and disease?

STE24 dysfunction has significant implications for cellular pathology and potential disease connections. Unresolved translocon clogging, which can occur in the absence of functioning STE24, may result in diseases such as type 2 diabetes . The inability to clear clogged translocons prevents them from being used as passages for other proteins, disrupting normal cellular protein trafficking and potentially leading to ER stress .

In human cells, mutations in ZMPSTE24 (the human homologue of STE24) are associated with progeroid disorders, including restrictive dermopathy and mandibuloacral dysplasia. The finding that disease-associated mutant forms of ZMPSTE24 fail to clear the translocon suggests that impaired translocon quality control may contribute to these disorders .

Research in Saccharomyces cerevisiae has shown that deletion of STE24 generates notable ER stress and interferes with membrane protein topology . These phenotypes are not shared by other a-factor processing enzymes, indicating that STE24's role in maintaining cellular homeostasis extends beyond its function in CAAX processing. Understanding how STE24 dysfunction contributes to cellular pathology may provide insights into the mechanisms underlying various human diseases and potentially identify new therapeutic targets.

Data Table: Comparison of STE24 Functions and Characteristics

FeatureSTE24 Function/CharacteristicExperimental EvidenceCitations
Cellular LocalizationEndoplasmic Reticulum MembraneImmunofluorescence and subcellular fractionation
Structural Organization7 transmembrane helices forming water-filled barrel-shaped chamber with capped endsX-ray crystallography
Primary Functions1. CAAX processing
2. Translocon quality control
Genetic and biochemical assays
Substrate SpecificityRecognizes only isoprenylated substratesRadioactive coupled methyltransferase-protease assay
Translocon SpecificityDegrades clogged proteins in posttranslational translocation (PTT) but not cotranslational translocation (CTT)Western blot analysis of engineered clogger proteins
Cross-Species FunctionalityFunction conserved in human ZMPSTE24 and S. pombe mam4pComplementation studies
Disease ImplicationsHuman ZMPSTE24 mutations linked to progeroid disorders; Translocon clogging linked to type 2 diabetesMutant analysis and disease models
Role in Cellular StressDeletion causes ER stress and interferes with membrane protein topologyExperimental observation in Δste24 cells

What are the unresolved questions about STE24 mechanism and function?

Despite significant advances in understanding STE24, several important questions remain unresolved. While the X-ray structure of STE24 provides insights into its unique architecture, it offers only minimal mechanistic information about how substrates enter and exit the chamber, how they are recognized, and how catalysis occurs . Further structural and biochemical studies are needed to elucidate the precise mechanism of substrate recognition and catalysis.

Additionally, the exact molecular details of how STE24 approaches clogged translocons, recognizes clogged substrates, and generates cleavage fragments remain to be fully characterized. The specificity of STE24 for posttranslational translocation versus cotranslational translocation suggests complex regulatory mechanisms that are not yet understood . Understanding these mechanisms could provide insights into the broader question of how cells maintain the fidelity of protein translocation and respond to translocation errors.

How might understanding STE24 contribute to therapeutic developments?

Understanding the mechanistic details of STE24 function could potentially contribute to therapeutic developments for diseases associated with translocon dysfunction or protein processing defects. Since unresolved translocon clogging may result in diseases such as type 2 diabetes, insights into how STE24 clears clogged translocons could inform strategies to prevent or treat such conditions .

In human cells, mutations in ZMPSTE24 are associated with progeroid disorders. Elucidating how these mutations affect ZMPSTE24's ability to clear translocons could provide a mechanistic understanding of these disorders and potentially identify targets for therapeutic intervention . Furthermore, the finding that disease-associated mutant forms of ZMPSTE24 fail to clear the translocon suggests that enhancing translocon quality control might be a therapeutic approach for these disorders.

By continuing to investigate the structure-function relationships of STE24, researchers may also identify small molecules that could modulate its activity, potentially offering new therapeutic tools for diseases associated with translocon dysfunction or aberrant protein processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.