Recombinant Saccharomyces cerevisiae Calcium channel YVC1 (YVC1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Calcium Homeostasis

YVC1 mediates vacuolar calcium efflux to the cytoplasm under stress conditions. Key mechanisms include:

  • Mechanosensitive gating: Activated by osmotic pressure changes or membrane stretch, releasing Ca²⁺ during vacuolar shrinkage .

  • Calcium-induced calcium release (CICR): Cytoplasmic Ca²⁺ at millimolar concentrations amplifies channel activity .

  • Redox regulation: Glutathionylation of cysteine residues (Cys-17, Cys-79, Cys-191) modulates channel activation under oxidative stress .

Recombinant Production and Applications

Recombinant YVC1 is produced in heterologous systems for functional studies. Commercial products include:

Table: Recombinant YVC1 Products

Product TypeHost SystemPurityApplications
Full-length protein Cell-free expression≥85%Structural studies, in vitro assays
Partial protein E. coli/Yeast≥85%Antibody production, binding assays
Polyclonal antibody RabbitAffinity-purifiedWestern blot, ELISA

4.1. Calcium Signaling and Stress Responses

  • Deleting YVC1 in Candida albicans reduces cytoplasmic calcium pulses under alkaline pH or hypertonic shock, impairing hyphal growth and virulence .

  • In S. cerevisiae, YVC1-deficient strains show attenuated calcium fluctuations during endoplasmic reticulum (ER) stress, improving cell viability under tunicamycin treatment .

4.2. Mechanistic Insights from Mutational Studies

  • Cys-343: Located in TMD2, this residue influences redox sensitivity but is not conserved across fungi .

  • Voltage-dependent gating: Two distinct gating systems respond to membrane potential and cytoplasmic Ca²⁺ levels .

Research Applications

  • Calcium flux assays: Recombinant YVC1 facilitates studies on vacuolar Ca²⁺ dynamics using patch-clamp electrophysiology .

  • Pathogenicity studies: Used to dissect YVC1’s role in fungal virulence and biofilm formation .

  • Drug discovery: Target for antifungal agents due to its role in stress adaptation .

Open Questions and Future Directions

  • Structural regulation: How do PI(3)P lipids and mechanical forces cooperatively gate YVC1 ?

  • Therapeutic targeting: Can modulating YVC1 activity enhance antifungal efficacy without harming host cells ?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YVC1; YOR087W; YOR088W; YOR3151W; Calcium channel YVC1; TRP homolog; Yeast vacuolar conductance protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-675
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YVC1
Target Protein Sequence
MVSANGDLHLPISNEQCMPENNGSLGFEAPTPRQILRVTLNLKYLIDKVVPIVYDPNDIV CDHSEILSPKVVKLAYEACGGNPKDKANKRKYQSVIIFSLLKVCEWYSILATMEVHNAKL YETRNLASQQLCKLLIEREETRDLQFLFMQLLLRRYVINENDEDQEPLNALELATDMHCT TVIGSSGFQRCLKWIWRGWIVQNGLDPTTFIKDDSLAEVSLISHFNPVRLKAPVYQNYLQ MIFSFLFLGLYTLVVNGKDSERVQSFDLLESIFYVFNTGFILDELTKLYYIGYAHLSFWN LFNDTTYLIITFAMGFRAMSVTPLNAKYSSEDWDKISYRVLSCAAPFVWSRLLLYLESQR FIGIMLVILKHMMKESIVFFFLLFLIMIGFTQGFLGLDSADGKRDITGPILGNLTITVLG LGSFDVFEEFAPPYAAILYYGYYFIVSVILLNILIALYSTAYQKVIDNADDEYMALMSQK TLRYIRAPDEDVYVSPLNLIEVFMTPIFRILPPKRAKDLSYTVMTIVYSPFLLLISVKET REARRIKYNRMKRLNDDANEYDTPWDLTDGYLDDDDGLFSDNRNSGMRATQLKNSRSLKL QRTAEQEDVHFKVPKKWYKNVKKCSPSFEQYDNDDTEDDAGEDKDEVKELTKKVENLTAV ITDLLEKLDIKDKKE
Uniprot No.

Target Background

Function
Essential for calcium ion release from the vacuole in response to hyperosmotic stress.
Gene References Into Functions
  1. Yvc1p contains nine cysteine residues; eight are in the cytoplasmic regions, and one is in the transmembrane domain. Three of these cysteines (Cys-17, Cys-79, and Cys-191) have been shown to undergo specific glutathionylation. PMID: 27708136
Database Links

KEGG: sce:YOR087W

STRING: 4932.YOR087W

Protein Families
Transient receptor (TC 1.A.4) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is YVC1 and where is it localized in Saccharomyces cerevisiae?

YVC1 (yeast vacuolar conductance 1), also known as transient receptor potential yeast1 (TRPY1), is the only member of the TRP superfamily expressed in Saccharomyces cerevisiae. It is a calcium-permeable channel responsible for the efflux of vacuolar Ca²⁺ to the cytoplasm. Immunodetection of tagged YVC1 gene product has conclusively demonstrated that YVC1 is primarily localized in the vacuole membrane, not in other intracellular membranes . This localization has been confirmed through subcellular fractionation techniques using Accudenz density gradient centrifugation followed by Western blot analysis . When researchers attempt to overexpress YVC1, the excess protein accumulates in the endoplasmic reticulum rather than the vacuole, though the functional channels remain confined to the vacuolar membrane .

What is the structural composition of the YVC1 channel?

YVC1 comprises 675 amino acid residues with a molecular weight of 78 kDa . Similar to all TRP family members, YVC1 contains six predicted transmembrane domains (TMDs) with cytosolic N- and C-termini and a hydrophobic pore region located between TMD5 and TMD6 . TMD6 forms part of the ion conduction pathway and participates in cation channel gating deactivation . A key structural feature is the short amino acid sequence motif "VILLNILIALY" between residues 448-458 in TMD6 . For experimental purposes, researchers have successfully created epitope-tagged versions of YVC1, including HA-tagged and His-tagged constructs, which maintain functional channel activity while allowing immunological detection .

How does YVC1 function as a mechanosensitive calcium channel?

YVC1 functions as both a mechanosensor and a calcium channel, with its primary role being to release Ca²⁺ from the vacuole into the cytoplasm in response to mechanical stimuli, particularly osmotic upshock . The channel exhibits dual activation mechanisms:

  • Mechanical activation: YVC1 responds directly to membrane tension caused by osmotic pressure differences. Pressures of tens of millimeters of Hg activate the channel in both whole-vacuole recording mode and excised cytoplasmic-side-out mode . This activation occurs independently of Ca²⁺ concentration.

  • Calcium-induced activation: Once activated, YVC1 can be further stimulated by cytoplasmic Ca²⁺, creating a potential Ca²⁺-induced Ca²⁺ release amplification mechanism .

When osmotic upshock occurs, water is drawn from the cytoplasm and then from the vacuole, creating a temporary osmotic imbalance across the vacuolar membrane. This imbalance produces osmotic pressure that activates YVC1, releasing vacuolar Ca²⁺ into the cytoplasm . As water flux across the membrane eventually recedes, YVC1 activity decreases accordingly .

What are the basic electrophysiological properties of YVC1?

YVC1 exhibits distinct electrophysiological properties that can be characterized through patch-clamp recording techniques:

  • Single-channel conductance: Approximately 320-400 pS under standard recording conditions

  • Channel density: Minimum of 100 channels per vacuole

  • Rectification: Inwardly rectifying with open probability (P<sub>o</sub>) peaking at about -80 mV (cytoplasm negative) and falling to near zero at positive voltages

  • Activation characteristics: Activates in response to mechanical pressure, osmotic shock, and calcium

  • Temporal response: Channel activity typically peaks within tens of seconds after osmotic stimulation but subsides to a low level afterward

These properties can be measured using whole-vacuole patch-clamp recordings or excised membrane patches in cytoplasmic-side-out configuration .

How can researchers effectively study YVC1 mechanosensitivity?

Studying YVC1 mechanosensitivity requires specialized techniques due to the fragility of isolated vacuoles. Researchers should consider these methodological approaches:

  • Patch-clamp recording configurations:

    • Whole-vacuole recording mode, where the patch pipette creates a seal with the entire vacuole

    • Excised cytoplasmic-side-out patches, which allow direct access to the cytoplasmic face of the channel

  • Mechanical stimulation methods:

    • Direct pressure application via recording pipette (positive or negative pressure)

    • Osmotic challenges using hyperosmotic solutions (0.8-1.5 osmolar compared to baseline 0.4 osmolar)

    • Various osmolytes can be used, including NaCl, KCl, or sorbitol

  • Recording conditions and equipment:

    • EPC7 patch-clamp amplifier at room temperature

    • Signals filtered at 1 kHz before digitization

    • Analysis using appropriate software (e.g., PCLAMP 6.0)

    • Single-channel slope conductance determination by linear regression from I/V curves

  • Technical challenges to anticipate:

    • Vacuoles often detach from pipettes or break gigaseals during osmolarity changes

    • Bath solution changes must be performed gently to maintain recording integrity

    • Vacuolar shrinkage can complicate maintenance of stable recordings

What is the relationship between YVC1 and ER stress response in yeast?

The relationship between YVC1 and ER stress response reveals important insights for researchers exploring calcium signaling in stress conditions:

YVC1 deletion has been shown to modify the cellular response to ER stress, particularly in strains with altered calcineurin signaling. Experimental evidence demonstrates that deletion of YVC1 can recover growth defects in calcineurin-deficient (cnb1Δ/Δ) strains under ER stress conditions induced by tunicamycin (TN) .

Key experimental findings include:

  • The double mutant strain (cnb1Δ/Δ yvc1Δ/Δ) exhibits better growth than the single cnb1Δ/Δ mutant when exposed to ER stress agents on solid media and in liquid culture .

  • Cell death analysis using propidium iodide (PI) staining and flow cytometry shows that under TN treatment, the cnb1Δ/Δ strain has a higher death rate (39.72%) compared to the cnb1Δ/Δ yvc1Δ/Δ double mutant (26.8%) .

  • The protective effect of YVC1 deletion appears to be related to reduced cellular calcium levels, which may mitigate ER stress sensitivity in the absence of functional calcineurin .

For researchers investigating this relationship, methodological approaches should include:

  • Growth assays on solid media containing ER stress agents

  • Liquid culture growth curves with precise OD<sub>600</sub> measurements

  • Cell viability assessments using appropriate vital dyes and flow cytometry

  • Genetic manipulation creating single and double knockout strains

What are the experimental considerations when expressing recombinant YVC1?

Expressing recombinant YVC1 presents several challenges and considerations that researchers should address:

  • Expression system selection:

    • Homologous expression in S. cerevisiae is preferable to maintain proper folding and trafficking

    • YVC1-deletion strains provide a clean background for functional studies

  • Tag selection and positioning:

    • HA-tagging or His-tagging have been successfully used without disrupting channel function

    • Tags should be engineered through homologous recombination or plasmid-based expression systems

    • Example molecular biology approach: PCR with primers containing appropriate restriction sites (e.g., XmaI at 5' end, XhoI at 3' end) and tag sequences

  • Expression level control:

    • Over-expression can lead to protein accumulation in the ER rather than the vacuole

    • Repressible promoters allow controlled expression levels

    • No increase in functional channel numbers is typically observed in over-expressing strains compared to wild-type

  • Functional verification methods:

    • Patch-clamp recording to confirm channel conductance

    • Subcellular fractionation and Western blotting to verify protein expression and localization

  • Trafficking considerations:

    • When GFP-YVC1 constructs are over-expressed, fluorescence is often observed in the ER rather than the vacuole

    • This suggests limitations in the cellular machinery for YVC1 trafficking

How can YVC1 be used as a model for studying mechanosensation in eukaryotes?

YVC1 offers several advantages as a model system for studying mechanosensation in eukaryotes:

  • Evolutionary significance:

    • As a member of the TRP channel family with mechanosensitive properties, YVC1 shares homology with mechanosensitive channels in higher eukaryotes

    • Several TRP-family channels in animals have been associated with mechanosensation, making YVC1 a valuable evolutionary comparison point

  • Experimental accessibility:

    • S. cerevisiae is genetically tractable, allowing precise genetic manipulations

    • The vacuole is amenable to electrophysiological studies despite technical challenges

    • Direct correlation between mechanical stimuli and channel activation can be established

  • Methodological approaches:

    • Combine patch-clamp electrophysiology with controlled mechanical stimulation

    • Measure Ca²⁺ flux using fluorescent indicators in response to osmotic challenges

    • Compare wild-type and YVC1-deleted strains to establish specificity of responses

  • Mechanosensation mechanism studies:

    • YVC1 can help elucidate how membrane tension is converted to channel gating

    • Structure-function relationships can be explored through mutagenesis of specific domains

    • The relationship between mechanosensation and Ca²⁺-induced activation provides insight into signal amplification mechanisms

What techniques are available for measuring YVC1-mediated calcium flux in intact yeast cells?

Researchers studying YVC1-mediated calcium flux in intact cells can employ several complementary approaches:

  • Calcium-sensitive fluorescent indicators:

    • Load yeast cells with membrane-permeable fluorescent Ca²⁺ indicators

    • Apply osmotic upshock while monitoring fluorescence changes

    • Compare responses between wild-type, YVC1-deleted, and YVC1-overexpressing strains

  • Genetically encoded calcium indicators (GECIs):

    • Express calcium-sensitive fluorescent proteins (e.g., GCaMP variants) in the yeast cytoplasm

    • These allow longer-term monitoring without dye leakage issues

    • Can be targeted to specific subcellular compartments to measure localized Ca²⁺ changes

  • Real-time calcium measurements during osmotic stress:

    • Mount yeast cells in flow chambers that allow rapid solution exchange

    • Simultaneously measure cell volume changes (through bright-field imaging) and calcium levels

    • Correlate the timing of osmotic shock, cell shrinkage, and calcium release

  • Genetic interaction approaches:

    • Combine YVC1 mutations with modifications to other calcium transporters

    • Assess the relative contributions of different calcium sources during osmotic stress

    • Example: Comparing calcium release in single YVC1 deletion versus double mutants with altered plasma membrane calcium channels

How does YVC1 integrate with other calcium signaling pathways in yeast?

YVC1 functions within a complex network of calcium signaling pathways in S. cerevisiae. Understanding these interactions requires examining:

  • Relationship with plasma membrane calcium channels:

    • While YVC1 mediates vacuolar calcium release, plasma membrane channels Cch1 and Mid1 regulate calcium influx from the extracellular environment

    • These systems may work in coordination during stress responses

  • Interaction with calcineurin signaling pathway:

    • Calcineurin (CNB1) responds to calcium signals and regulates numerous cellular processes

    • YVC1 deletion affects ER stress sensitivity in calcineurin-deficient strains, suggesting interconnected roles

    • Experimental approach: Create double knockout strains and assess phenotypes under various stress conditions

  • Role in calcium homeostasis:

    • YVC1 is part of the machinery regulating cellular calcium levels

    • Its activation by osmotic stress transiently increases cytosolic calcium

    • This may trigger downstream calcium-dependent processes

Research methodologies to explore these integrations include:

  • Genetic interaction studies (synthetic lethality, suppressor screens)

  • Calcium imaging in strains with various combinations of calcium channel mutations

  • Transcriptional profiling to identify genes regulated by YVC1-mediated calcium release

What are the current contradictions in YVC1 research that require resolution?

Several unresolved questions and apparent contradictions exist in the YVC1 research field:

What methodological advances would enhance YVC1 research?

Future YVC1 research would benefit from several methodological innovations:

  • Improved electrophysiological approaches:

    • Development of automated patch-clamp systems compatible with yeast vacuoles

    • Techniques for long-term stable recordings during osmotic manipulations

    • Combined electrophysiology and super-resolution microscopy

  • Structural studies:

    • Cryo-EM determination of YVC1 structure in different conformational states

    • Comparative structural analysis with other TRP family channels

    • Structure-guided mutagenesis to identify key functional domains

  • In vivo sensors:

    • Development of tension-sensitive fluorescent proteins to monitor membrane tension in real-time

    • Targeted calcium indicators to measure calcium flux specifically associated with YVC1 activity

    • Optogenetic tools to activate or inhibit YVC1 with spatial and temporal precision

  • High-throughput screening approaches:

    • Development of yeast-based assays suitable for identifying YVC1 modulators

    • Screen for compounds that specifically target mechanosensitive properties

    • Genetic screens to identify novel YVC1 interactors and regulators

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.