Recombinant Saccharomyces cerevisiae Calnexin homolog (CNE1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Calnexin homolog (CNE1) refers to the protein produced through recombinant DNA technology that is homologous to mammalian calnexin and calreticulin found in the yeast Saccharomyces cerevisiae . CNE1, also known as calnexin homolog, is an endoplasmic reticulum (ER) membrane protein that functions as a constituent of the S. cerevisiae ER protein quality control system .

Identification and Characteristics

  • Using a polymerase chain reaction strategy, the CNE1 gene was identified and isolated in Saccharomyces cerevisiae .

  • The protein predicted from the CNE1 DNA sequence shares motifs with calnexin and calreticulin, exhibiting 24% identity and 31% similarity at the amino acid level with mammalian calnexin .

  • Cne1p is an integral membrane protein based on its solubility in detergents and its resistance to extraction from membranes by urea, high salt, and sodium carbonate .

  • Unlike calnexins, Cne1p's carboxyl-terminal membrane-spanning domain terminates directly .

  • Cne1p is N-glycosylated, indicated by its changed mobility from 76 to 60 kDa after endoglycosidase H digestion .

  • Subcellular fractionation and confocal immunofluorescence microscopy have exclusively located Cne1p in the endoplasmic reticulum (ER), despite the absence of known ER retention motifs .

  • Although six Ca2+^{2+}-binding proteins were found in the ER fractions, they were all soluble proteins, and no Ca2+^{2+} binding activity has been detected for Cne1p .

Gene and Protein Information

FeatureDescription
Gene NameCNE1
Ordered Locus NamesYAL058W
ORF NamesFUN48
SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.P27825
AA SequenceTSLLSNVTLAEDSFWEHFQAYTNTKHLNQEWITSEAVNNEGSKIYGAQWRLSQGRLQGSAWDKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNVEALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKITHESKLRYLQEMPLSKLTDTSQSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPPITPPLMIPDVSVAKPHDWDD RIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEIINPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFWSGSPNMLISNIYVGKNVTEAQIIGNKTWLMRDRAFRGSDGPTERKFMNSRLGNLQTTFHNERESPNPFDRIIDRILEQPLKFVLTAAVVLLTTSVLCCVVFT
Expression Region20-502

Function and Role in Saccharomyces cerevisiae

  • Disruption of the CNE1 gene does not cause cell inviability or significant effects on secreted protein levels, such as α\alpha-pheromone or acid phosphatase .

  • CNE1 disrupted cells show increased cell-surface expression of an ER-retained temperature-sensitive mutant of the α\alpha-pheromone receptor, ste2-3p, and increased secretion of heterologously expressed mammalian α\alpha1-antitrypsin .

  • Cne1p functions as a constituent of the S. cerevisiae ER protein quality control system .

  • Calnexin may interact with protein disulfide isomerase (PDI) under heat stress conditions, and the induction of PDI in the ER may recover part of calnexin's function in calnexin-disrupted yeast, resulting in the same growth rate as in wild-type yeast .

Comparison with Schizosaccharomyces pombe Calnexin

  • In Schizosaccharomyces pombe, calnexin (Cnx1p) is essential for viability under normal conditions, and S. pombe does not encode a calreticulin ortholog, allowing direct analysis of calnexin's cellular roles .

  • Certain calnexin mutants devoid of chaperone function can complement the calnexin knockout, suggesting that the essential function of calnexin in S. pombe is not its chaperone activity but another undefined cellular role .

  • A mutant of calnexin lacking its highly conserved central domain (Δ\Deltahcd_cnx1) induces a state in which cnx1+ is no longer required for viability, named Cin (for calnexin-independent) .

  • Cin cells exhibit cell-wall defects that are corrected by the reintroduction of calnexin, indicating that although the Cin state confers viability, it does not compensate for all calnexin functions in S. pombe .

Regulation and Expression

  • Expression data is derived from records in the Gene Expression Omnibus (GEO), with data log2 transformed and normalized .

  • The histogram division at 0.0 separates down-regulated (green) conditions and datasets from up-regulated (red) ones .

  • Clicking "Expression Details" allows viewing of all expression annotations and details for the locus, including a visualization of genes that share a similar expression pattern .

Potential Applications

Recombinant Saccharomyces cerevisiae Calnexin homolog (CNE1) and its related studies have potential applications in:

  • Understanding Protein Quality Control: Elucidating the mechanisms of protein folding, assembly, and degradation in the ER.

  • Drug Discovery: Identifying potential drug targets related to ER stress and protein misfolding diseases.

  • Biotechnology: Improving recombinant protein production in yeast by manipulating the protein quality control machinery.

  • Cellular Stress Response: Investigating the role of calnexin in cellular stress responses, such as heat stress and ER stress.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNE1; YAL058W; FUN48; Calnexin homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-502
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CNE1
Target Protein Sequence
TSLLSNVTLAEDSFWEHFQAYTNTKHLNQEWITSEAVNNEGSKIYGAQWRLSQGRLQGSA WDKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNV EALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKITHESKLRYLQEMPLSKLTDTS QSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPPITPPLMIPDVSVAKPHDW DDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEH GEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEIINPNYMGEWHPPEIENPLY YEEQHPLRIENVISGVILEFWSGSPNMLISNIYVGKNVTEAQIIGNKTWLMRDRAFRGSD GPTERKFMNSRLGNLQTTFHNERESPNPFDRIIDRILEQPLKFVLTAAVVLLTTSVLCCV VFT
Uniprot No.

Target Background

Function

Recombinant Saccharomyces cerevisiae Calnexin homolog (CNE1) interacts with newly synthesized glycoproteins within the endoplasmic reticulum (ER). It plays a crucial role in facilitating protein assembly and/or retaining unassembled protein subunits within the ER. CNE1 is a key component of the ER quality control system, responsible for retaining improperly folded proteins.

Gene References Into Functions
  1. Cne1p interacts with misfolded lysozyme proteins. PMID: 25229868
  2. Cne1p functions as a molecular chaperone in Saccharomyces cerevisiae. PMID: 15173200
  3. Calnexin deletion leads to increased levels of protein disulfide-isomerase mRNA under heat stress, without affecting yeast growth rate. PMID: 17952377
  4. Under heat stress, BiP induction in the ER partially compensates for calnexin deficiency, resulting in a wild-type growth rate in calnexin-disrupted yeast. PMID: 18661113
Database Links

KEGG: sce:YAL058W

STRING: 4932.YAL058W

Protein Families
Calreticulin family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the structural organization of Cne1p?

Cne1p contains several key structural elements that are conserved among calnexin homologs. Most notably, it possesses a conserved P-domain and lectin site similar to those found in mammalian calnexin . The P-domain is critical for the protein's chaperone function, while the lectin site enables binding to monoglucosylated oligosaccharides such as G1M9 . Cne1p is an integral membrane protein that requires detergents for solubilization and cannot be extracted from membranes by 2.5 M urea, high salt, or sodium carbonate at pH 11.5 . The protein is N-glycosylated, as evidenced by its mobility shift from 76 to 60 kDa after endoglycosidase H digestion . Unlike mammalian calnexins, the predicted carboxyl-terminal membrane-spanning domain of Cne1p terminates directly .

Where is Cne1p localized within the cell?

Cne1p is exclusively localized to the endoplasmic reticulum (ER) of Saccharomyces cerevisiae. This localization has been confirmed through multiple experimental approaches including differential and analytical subcellular fractionation as well as confocal immunofluorescence microscopy . Interestingly, Cne1p maintains this strict ER localization despite lacking known ER retention motifs that are typically found in other ER-resident proteins . This suggests that novel mechanisms may be responsible for Cne1p retention within the ER, which could be an interesting subject for further research.

What is the primary function of Cne1p in yeast cells?

Cne1p functions as a molecular chaperone in the endoplasmic reticulum involved in the folding and quality control of nascent glycoproteins . It assists in the proper folding of glycoproteins through interactions with monoglucosylated oligosaccharide moieties (Glc₁Man₉GlcNAc₂) . Like mammalian calnexin, Cne1p helps ensure that only properly folded proteins proceed through the secretory pathway, while improperly folded proteins are retained in the ER . Experimental evidence indicates that Cne1p is a constituent of the S. cerevisiae ER protein quality control apparatus, as disruption of the CNE1 gene leads to increased cell-surface expression of ER-retained mutant proteins and increased secretion of heterologously expressed proteins .

How do the P-domain and lectin site contribute to Cne1p chaperone function?

The P-domain and lectin site of Cne1p cooperate to facilitate its full chaperone functionality. In vitro studies using recombinant P-domain, P-domain deletion mutants, and lectin site mutants (E181A and E398A) have demonstrated that both structural elements are essential for optimal chaperone activity . The lectin site enables Cne1p to bind monoglucosylated oligosaccharides (G1M9), as confirmed through experiments with lectin site mutants . When either the P-domain is deleted or the lectin site is mutated, Cne1p shows reduced ability to suppress protein aggregation, as measured using model substrates like citrate synthase and chicken egg yolk immunoglobulin . Additionally, these mutants exhibit decreased capacity to enhance the refolding of denatured citrate synthase . These findings suggest that the P-domain and lectin site work synergistically, with neither being sufficient alone for complete chaperone function. The mechanistic model proposes that the lectin site provides substrate specificity through binding to glycan moieties, while the P-domain facilitates the physical process of protein folding.

What experimental approaches are most effective for studying Cne1p function?

Several complementary methodologies have proven effective for investigating Cne1p function:

  • Gene disruption studies: CNE1 knockout strains allow for assessment of phenotypic changes including alterations in protein secretion patterns and cell-surface expression of ER-retained proteins .

  • Domain-specific mutants: Creating P-domain deletion mutants and point mutations in the lectin site (such as E181A and E398A) enables dissection of domain-specific contributions to chaperone function .

  • In vitro chaperone assays: Using model substrates like citrate synthase to measure protein aggregation suppression and refolding enhancement provides quantitative assessment of chaperone activity .

  • Binding assays with monoglucosylated oligosaccharides: These experiments can confirm the lectin function of Cne1p and evaluate the impact of specific mutations .

  • Subcellular fractionation and confocal microscopy: These approaches can determine the precise localization of Cne1p and its mutant variants within cellular compartments .

A comprehensive study would typically combine multiple approaches to gain a complete understanding of Cne1p function in different contexts.

How does Cne1p compare functionally with mammalian calnexin and calreticulin?

  • Structural differences: Cne1p lacks the cytoplasmic tail found in mammalian calnexin and has a directly terminating membrane-spanning domain .

  • Calcium binding: Unlike mammalian calnexin, Cne1p does not demonstrate calcium binding activity, suggesting different regulatory mechanisms .

  • Redundancy: In mammalian cells, calreticulin serves as a soluble homolog of calnexin with overlapping functions. S. cerevisiae lacks calreticulin, making Cne1p the sole representative of this chaperone family in yeast .

The table below summarizes key differences between Cne1p and mammalian calnexin:

FeatureCne1p (S. cerevisiae)Mammalian Calnexin
Amino acid identityReference24% identical to Cne1p
Membrane topologyIntegral membrane proteinIntegral membrane protein with cytoplasmic tail
Calcium bindingNot detectedPresent
Functional redundancyNo calreticulin in yeastFunctions partially overlap with calreticulin
ER retention mechanismNo known ER retention motifsContains KDEL-like retention signal
N-glycosylationPresent (76 to 60 kDa shift after EndoH)Present

These differences make Cne1p an interesting comparative model for understanding the evolution and essential functions of the calnexin/calreticulin family of chaperones.

What is the relationship between CNE1 and the unfolded protein response (UPR) in yeast?

While the search results don't directly address the relationship between CNE1 and the unfolded protein response in S. cerevisiae, we can draw insights from related research on protein quality control mechanisms. In yeast, the UPR is primarily mediated by the HAC1 transcription factor, which undergoes unconventional splicing during ER stress .

The HAC1 gene has been shown to improve secretion of recombinant proteins in another yeast species, Yarrowia lipolytica, by preventing excessive accumulation of recombinant proteins within cells . When HAC1 is co-overexpressed with a recombinant protein, it caused a nearly 7-fold drop in the retained fraction of the protein while promoting its secretion .

The table below shows the effect of HAC1 co-expression on protein secretion in Y. lipolytica:

StrainHAC1 expression levelRetained protein [kRFU L⁻¹]Secreted protein [kRFU L⁻¹]
scYFP1.0812,108.30 ± 5,715.6224,785.28 ± 187.33
HAC1_scYFP21.0118,922.90 ± 3,224.3960,123.13 ± 847.64

While this data is from Y. lipolytica rather than S. cerevisiae, it suggests a potential relationship between UPR activation and the function of ER chaperones like Cne1p. Future research could explore whether HAC1 directly regulates CNE1 expression in S. cerevisiae and how this might affect the protein quality control system.

What methodologies are best for expressing and purifying recombinant Cne1p for structural studies?

Based on the search results and established protocols for membrane proteins, the following methodology would be suitable for expressing and purifying recombinant Cne1p:

  • Expression system selection: Either heterologous expression in E. coli or homologous expression in S. cerevisiae. The latter may be preferable to ensure proper folding and glycosylation.

  • Construct design: Include an affinity tag (His6 or GST) for purification. Consider creating a construct lacking the transmembrane domain for improved solubility if studying the luminal domain is sufficient.

  • Membrane protein extraction: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin for solubilization, as Cne1p is an integral membrane protein that requires detergents for extraction .

  • Purification strategy:

    • Affinity chromatography using the engineered tag

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Quality control: Verify proper folding using circular dichroism and assess glycosylation status with endoglycosidase H treatment, which should produce a mobility shift from 76 to 60 kDa on SDS-PAGE .

  • Functional validation: Confirm chaperone activity using in vitro aggregation suppression assays with model substrates such as citrate synthase .

This approach should yield functional recombinant Cne1p suitable for structural and functional studies, though modifications may be necessary depending on specific experimental requirements.

How can CNE1 be genetically manipulated to study its function?

Several genetic approaches have proven effective for studying CNE1 function:

  • Gene knockout/disruption: Complete deletion of CNE1 is viable in S. cerevisiae, allowing for phenotypic analysis . This approach demonstrated that CNE1 disruption leads to increased cell-surface expression of an ER-retained temperature-sensitive mutant protein (ste2-3p) and increased secretion of heterologously expressed mammalian alpha 1-antitrypsin .

  • Domain-specific mutations: Creating targeted mutations in functional domains provides insights into structure-function relationships. Examples include:

    • P-domain deletion mutants to study the role of this domain in chaperone function

    • Lectin site mutants (E181A and E398A) to investigate substrate binding mechanisms

  • Promoter replacements: Replacing the native CNE1 promoter with regulatable promoters (e.g., GAL1, CUP1) allows for controlled expression levels.

  • Fluorescent protein fusions: Creating Cne1p-GFP fusions enables real-time visualization of localization and dynamics within living cells.

  • Epitope tagging: Adding small epitope tags facilitates immunoprecipitation and co-immunoprecipitation experiments to identify interaction partners.

What role might CNE1 play in optimizing recombinant protein production in yeast?

CNE1 could play a significant role in optimizing recombinant protein production in yeast through its function in the ER quality control system. When CNE1 was disrupted, researchers observed increased secretion of heterologously expressed mammalian alpha 1-antitrypsin , suggesting that modulating CNE1 activity could enhance recombinant protein secretion.

Drawing parallels from studies with HAC1 in Y. lipolytica, where co-overexpression of HAC1 with a recombinant protein improved secretion , a comprehensive approach to optimizing protein production might involve careful regulation of both UPR components and specific chaperones like Cne1p.

Potential strategies for leveraging CNE1 in recombinant protein production include:

  • Fine-tuned expression: Rather than complete deletion or overexpression, finding optimal CNE1 expression levels that balance protein folding assistance with ER retention.

  • Engineering domain-specific variants: Developing Cne1p variants with modified substrate recognition or retention properties to enhance secretion of specific target proteins.

  • Co-expression strategies: Coupling CNE1 modulation with overexpression of other folding factors or UPR components like HAC1.

  • Conditional regulation: Implementing temperature or chemical-dependent regulation of CNE1 to allow for phase-specific optimization during production processes.

Future research could systematically evaluate these approaches to develop strain-specific and protein-specific optimization strategies.

How can functional assays of Cne1p be designed and interpreted?

Designing robust functional assays for Cne1p requires consideration of its dual roles in glycoprotein binding and general chaperone activity. The following assays have proven effective:

  • Glycoprotein binding assays:

    • Using purified monoglucosylated oligosaccharides (G1M9) to assess lectin site function

    • Comparing wild-type Cne1p with lectin site mutants (E181A and E398A) as controls

    • Quantifying binding through techniques such as surface plasmon resonance or fluorescence anisotropy

  • Protein aggregation suppression assays:

    • Monitoring thermal aggregation of model substrates like citrate synthase

    • Measuring light scattering at 360 nm to quantify aggregation in the presence and absence of Cne1p

    • Comparing wild-type Cne1p with domain-specific mutants

  • Protein refolding enhancement assays:

    • Denaturing citrate synthase and monitoring recovery of enzymatic activity during refolding

    • Assessing the ability of Cne1p to enhance refolding efficiency

    • Using domain-specific mutants to dissect the contribution of different Cne1p regions

  • In vivo trafficking assays:

    • Monitoring the fate of model glycoproteins in wild-type versus CNE1-disrupted cells

    • Using temperature-sensitive mutant proteins like ste2-3p that are normally retained in the ER

    • Quantifying surface expression through flow cytometry or functional assays

When interpreting results, it's important to consider:

  • The specificity of the observed effects (using appropriate controls)

  • The concentration dependence of chaperone activity

  • The potential for indirect effects in vivo

  • The distinctions between lectin-dependent and lectin-independent activities

Combining multiple assay types provides the most comprehensive understanding of Cne1p function.

How might Cne1p interact with other components of the ER quality control system?

While the search results don't directly address Cne1p interactions with other ER quality control components, we can infer potential interactions based on general knowledge of ER quality control systems and the data provided. In mammalian cells, calnexin operates within a broader "calnexin/calreticulin cycle" involving UDP-glucose:glycoprotein glucosyltransferase (UGGT) and ER α-glucosidases. Given the conserved nature of these systems, Cne1p likely participates in similar interaction networks.

Potential interaction partners for Cne1p may include:

  • Glycan-processing enzymes: Enzymes that modify N-linked glycans to generate the monoglucosylated oligosaccharides recognized by Cne1p's lectin domain.

  • Protein disulfide isomerases (PDIs): Enzymes that catalyze disulfide bond formation, which often work cooperatively with chaperones.

  • BiP/Kar2p and its co-chaperones: The major ER Hsp70 chaperone, which could function sequentially or in parallel with Cne1p.

  • ERAD components: Machinery involved in targeting terminally misfolded proteins for degradation.

  • UPR sensors: Proteins that detect ER stress and activate stress response pathways, potentially including Ire1p, which processes HAC1 mRNA.

Future research could employ co-immunoprecipitation, proximity labeling, or genetic interaction screens to identify and characterize these potential interactions, providing a more comprehensive understanding of Cne1p's role within the broader ER quality control network.

What are the implications of CNE1 for understanding human ER storage diseases?

The study of Cne1p in yeast provides valuable insights into the mechanisms of ER quality control that are relevant to human ER storage diseases. Many human genetic disorders result from mutations that cause protein misfolding, leading to ER retention and eventually cell dysfunction or death. Examples include cystic fibrosis, alpha-1-antitrypsin deficiency, and certain forms of diabetes.

Specifically, the findings that CNE1 disruption increases secretion of heterologously expressed mammalian alpha 1-antitrypsin suggests that modulating calnexin function could potentially alleviate some aspects of alpha-1-antitrypsin deficiency. Similarly, the demonstration that Cne1p's P-domain and lectin site cooperatively contribute to its chaperone function provides mechanistic insights that could inform therapeutic strategies targeting specific domains of human calnexin.

Yeast models offer several advantages for studying these diseases:

  • Simplified genetic background

  • Ease of genetic manipulation

  • Rapid growth and scalability

  • Conservation of fundamental ER quality control mechanisms

By determining how specific mutations affect Cne1p function and how these changes influence the fate of different substrate proteins, researchers can develop hypotheses about the molecular basis of human disease and potential therapeutic interventions. Future studies could express disease-associated human protein variants in yeast with modified CNE1 to evaluate potential corrective strategies.

How can systems biology approaches enhance our understanding of CNE1 function?

Systems biology approaches offer powerful tools for contextualizing the function of CNE1 within the broader cellular network:

  • Transcriptomics: RNA-seq analysis comparing wild-type and CNE1-disrupted strains under various stress conditions could reveal gene expression changes that compensate for or result from altered ER quality control. The study of HAC1 co-overexpression in Y. lipolytica demonstrates how such approaches can identify unexpected downstream effects of modulating ER function .

  • Proteomics: Mass spectrometry-based approaches could identify:

    • Direct Cne1p interaction partners through co-immunoprecipitation

    • Changes in the cellular proteome upon CNE1 disruption

    • Post-translational modifications of Cne1p that might regulate its function

  • Metabolomics: Analysis of metabolic changes in CNE1 mutants could reveal unexpected connections between ER quality control and cellular metabolism.

  • Network analysis: Integrating genetic interaction data, protein-protein interaction networks, and expression data could position CNE1 within the broader cellular network and identify key hubs that connect ER quality control to other cellular processes.

  • Mathematical modeling: Developing quantitative models of the calnexin cycle and related quality control processes could generate testable predictions about system behavior under different conditions.

These approaches would be particularly valuable for understanding the complex relationship between ER quality control, the unfolded protein response, and cellular homeostasis, providing a more comprehensive view of CNE1 function than traditional reductionist approaches alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.