Recombinant Saccharomyces cerevisiae Carrier protein YMC2, mitochondrial (YMC2)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Transport Mechanisms

YMC2 functions as a glutamate transporter across the mitochondrial inner membrane, with minor activity toward L-homocysteinesulfinate . Its transport is proton-dependent and saturable, with inhibition by mercuric chloride .

Key Functional Data

ParameterValue/ObservationSource
Substrate SpecificityGlutamate (Km = 0.15 mM); no activity for other amino acids or metabolites
Transport MechanismProton symport
Physiological RoleSupports C1 metabolism, mitochondrial protein synthesis, and photorespiration

In S. cerevisiae, YMC2 works redundantly with Agc1p to supply mitochondrial glutamate. Deletion of both ymc2 and agc1 abolishes mitochondrial glutamate uptake, leading to growth defects on non-fermentable carbon sources .

Experimental Findings

  • Genetic Complementation: Expression of YMC2 restores growth in ymc2Δagc1Δ yeast strains on acetate-containing media, confirming its role in glutamate transport .

  • Mitochondrial Swelling Assays: Wild-type mitochondria swell in isosmotic ammonium glutamate, a phenotype absent in ymc2Δagc1Δ mutants .

  • Substrate Competition: Glutamate transport is competitively inhibited by structural analogs like L-homocysteinesulfinate but not by aspartate or malate .

Comparative Analysis with Other Mitochondrial Carriers

YMC2 is distinct from other yeast mitochondrial carriers like Ctp1/Yhm2 (citrate transporters) or Sam5p (S-adenosylmethionine transporter) .

Carrier ProteinSubstratePhysiological RoleLocalization
YMC2GlutamateAmino acid metabolism, C1 metabolismMitochondria
Ctp1/Yhm2CitrateKrebs/glyoxylate cycle linkageMitochondria
Sam5pS-adenosylmethionineBiotin synthesis, mitochondrial SAM importMitochondria

Future Directions

Further studies could explore YMC2’s role in metabolic disorders linked to glutamate dysregulation or its interaction with mitochondrial enzymes in photorespiration. Structural elucidation via cryo-EM would enhance understanding of its transport mechanism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
YMC2; YBR104W; YBR0833; Carrier protein YMC2, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-329
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YMC2
Target Protein Sequence
VLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTLEVLRNLVKNEGVFAFYKGALT PLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGG VVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGL GTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLR KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGEE
Uniprot No.

Target Background

Database Links

KEGG: sce:YBR104W

STRING: 4932.YBR104W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of mitochondrial carrier protein YMC2 in S. cerevisiae?

YMC2 (Yhm2) is a mitochondrial carrier protein in Saccharomyces cerevisiae that functions primarily in the transport of metabolites across the inner mitochondrial membrane. Structurally, YMC2 belongs to the mitochondrial carrier family characterized by three tandemly repeated ~100 amino acid domains. The protein catalyzes the citrate/α-ketoglutarate shuttle between mitochondria and cytosol, which contributes significantly to the regeneration of cytosolic NADPH required for biosynthetic and antioxidant reactions. Additionally, YMC2 has been found to associate with mitochondrial nucleoids and plays a role in the replication and segregation of the mitochondrial genome .

How does YMC2 expression change during different growth phases in yeast?

YMC2 expression levels change significantly in response to metabolic conditions and growth phases. Research has demonstrated that during the transition from fermentative metabolism (exponential growth phase in glucose media) to respiratory metabolism (stationary phase), mRNA levels of YMC2 increase substantially by approximately 523% compared to exponential phase. When yeast cells are grown in ethanol-supplemented media (forcing respiratory metabolism), YMC2 expression in the exponential phase is approximately 3-fold higher than in glucose-supplemented media at the same growth phase. Furthermore, YMC2 mRNA levels double during the transition from exponential to stationary phase when cells are grown in ethanol media, suggesting that YMC2 plays a key role in the metabolic reprogramming associated with this transition .

What is the relationship between YMC2 and other mitochondrial carrier proteins in S. cerevisiae?

Unlike higher eukaryotes that typically have a single mitochondrial citrate carrier, S. cerevisiae possesses two: Ctp1 and YMC2 (Yhm2). These carriers demonstrate functional interplay, as the absence of one carrier leads to compensatory expression of the other. In Δctp1 mutant strains, YMC2 expression increases by approximately 40% in the exponential phase and 30% in the stationary phase compared to wild-type cells when grown in glucose-containing media. This suggests that while each carrier has distinct functions, they can partially compensate for each other's absence, particularly during respiratory metabolism. Unlike Ctp1, which primarily exchanges citrate for another tricarboxylate, YMC2 specifically catalyzes the citrate/α-ketoglutarate exchange, which indirectly facilitates the transport of reducing equivalents from mitochondria to cytosol .

What are the recommended protocols for recombinant expression and purification of YMC2?

For recombinant expression and purification of YMC2, the following protocol has proven effective:

  • Cloning: Insert the YMC2 coding sequence into a suitable expression vector (e.g., pET system) with an N-terminal His-tag for purification.

  • Expression system: Express in Escherichia coli (BL21 or C41/C43 strains optimized for membrane proteins) at lower temperatures (18-22°C) to improve proper folding.

  • Induction conditions: Use 0.1-0.5 mM IPTG for induction with extended expression times (18-24 hours).

  • Membrane fraction isolation: Harvest cells and disrupt by sonication or French press. Isolate membrane fractions through differential centrifugation.

  • Solubilization: Solubilize YMC2 using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration.

  • Purification: Purify using immobilized metal affinity chromatography followed by size exclusion chromatography.

  • Reconstitution: For functional studies, reconstitute purified YMC2 into proteoliposomes using a mixture of phosphatidylcholine and cardiolipin at a protein:lipid ratio of 1:100 .

This approach resembles methods successfully used for other mitochondrial carrier proteins and can be optimized specifically for YMC2.

How can researchers effectively measure YMC2 transport activity in vitro?

To measure YMC2 transport activity in vitro, the following liposome-based transport assay can be implemented:

  • Proteoliposome preparation: Reconstitute purified YMC2 into liposomes containing internal substrate (e.g., α-ketoglutarate at 20 mM concentration).

  • Transport initiation: Add external substrate (e.g., [14C]-labeled citrate at 1-5 μM) to initiate transport.

  • Timecourse measurement: Sample at intervals (15s, 30s, 1min, 2min, 5min) and terminate transport using specific inhibitors (e.g., pyridoxal 5'-phosphate or N-ethylmaleimide).

  • Quantification: Separate proteoliposomes by filtration and measure incorporated radioactivity by scintillation counting.

  • Kinetic analysis: Determine transport parameters (Km, Vmax) by varying substrate concentrations.

  • Transport modes: Test exchange rates with various substrate combinations to establish specificity profiles.

The assay should include appropriate controls, such as liposomes without protein and proteoliposomes treated with inhibitors, to account for non-specific binding and leakage .

What genetic approaches are most effective for studying YMC2 function in vivo?

Several genetic approaches have proven effective for studying YMC2 function in S. cerevisiae:

  • Gene deletion: Create ΔYHM2 strains through homologous recombination to assess phenotypic consequences. Growth defects are particularly evident during respiratory conditions.

  • Complementation studies: Transform ΔYHM2 strains with plasmids expressing wild-type or mutant YMC2 variants to identify critical residues or domains.

  • Regulated expression: Use the tetracycline-regulated or GAL1 promoter systems to control YMC2 expression levels temporally.

  • Fluorescent protein tagging: Generate C-terminal or N-terminal fusion proteins with GFP/mCherry to track localization and abundance while monitoring functionality.

  • Serial dilution growth assays: Assess growth of wild-type versus mutant strains on different carbon sources (glucose vs. ethanol) to evaluate respiratory competence.

When conducting these experiments, cells should be grown in appropriate media (YPAD or synthetic defined media) with exponential cultures maintained for 15-16 hours at 30°C to ensure vacuolar and mitochondrial uniformity across the cell population .

How does YMC2 contribute to NADPH homeostasis and antioxidant defense in yeast?

YMC2 plays a critical role in maintaining NADPH homeostasis through its citrate/α-ketoglutarate shuttle function. This mechanism works as follows:

  • YMC2 exports citrate from mitochondria to the cytosol in exchange for α-ketoglutarate.

  • In the cytosol, citrate is cleaved by ATP-citrate lyase to generate acetyl-CoA and oxaloacetate.

  • Oxaloacetate is reduced to malate by cytosolic malate dehydrogenase, consuming NADH.

  • Malate is then oxidized by cytosolic malic enzyme to generate pyruvate and NADPH.

  • This NADPH is utilized for biosynthetic reactions and maintaining the reduced state of glutathione, a key antioxidant.

Research demonstrates that deletion of YMC2 results in increased sensitivity to oxidative stress-inducing agents. In wild-type cells, YMC2 expression increases significantly (523%) during the transition to stationary phase, when cells face higher oxidative stress. This upregulation appears to be a protective mechanism, as the increased cytosolic NADPH generated through YMC2 activity supports antioxidant reactions. The citrate/α-ketoglutarate shuttle mediated by YMC2 thus represents a crucial link between carbon metabolism and redox balance in S. cerevisiae .

What is the role of YMC2 in mitochondrial genome maintenance?

Beyond its metabolite transport function, YMC2 has a significant role in mitochondrial genome maintenance through:

  • Association with nucleoids: YMC2 physically associates with mitochondrial nucleoids, the protein-DNA complexes that organize the mitochondrial genome.

  • Replication support: YMC2 contributes to mitochondrial DNA replication, potentially by ensuring appropriate metabolite concentrations within nucleoids.

  • Segregation function: During mitochondrial division, YMC2 participates in the proper segregation of mitochondrial DNA to daughter organelles.

  • Metabolic influence: The citrate/α-ketoglutarate exchange function may indirectly support nucleoid activities by maintaining appropriate redox conditions.

This dual functionality is particularly interesting as it connects metabolite transport with genome maintenance, suggesting that YMC2 may serve as a sensor linking metabolic status to mitochondrial genome regulation. Researchers investigating this aspect should employ fluorescence microscopy with dual-labeled strains (YMC2-GFP and nucleoid markers) and assess mtDNA stability in YMC2 mutants .

How does YMC2 interact with mitochondrial quality control systems?

YMC2 interfaces with mitochondrial quality control systems in several ways:

  • MDC-mediated regulation: Excess YMC2 is likely managed through mitochondrial-derived compartments (MDCs), which act as OMM-enriched traps that segregate and sequester surplus proteins from the mitochondrial surface. This prevents accumulation of non-functional protein that could disrupt membrane integrity.

  • Autophagy connection: Under stress conditions, upregulation of autophagy genes (ATG7, ATG34, ATG39, and ATG40) correlates with changes in mitochondrial carrier protein expression, suggesting coordination between mitochondrial protein turnover and autophagic pathways.

  • Protein import regulation: As a nuclear-encoded mitochondrial protein, YMC2 depends on import machinery whose function is monitored by quality control systems. Impaired import can trigger various mitochondrial stress responses.

For experimental investigation of these interactions, researchers should employ fluorescence microscopy to visualize MDC formation (using markers like Tom70) and monitor YMC2 localization during various stress conditions. Additionally, genetic approaches involving deletion or overexpression of key quality control components can reveal their impact on YMC2 function and abundance .

What are the key challenges in measuring YMC2 expression levels, and how can they be addressed?

Researchers face several challenges when measuring YMC2 expression levels, with these methodological solutions:

  • Low abundance challenge: YMC2 is often expressed at relatively low levels.
    Solution: Use reverse transcription quantitative PCR (RT-qPCR) with highly specific primers. For example, researchers successfully measured YMC2 mRNA showing a 523% increase during metabolic reprogramming using this approach.

  • Protein detection difficulties: Mitochondrial membrane proteins like YMC2 can be difficult to extract and detect.
    Solution: Optimize extraction using specialized buffers containing 1-2% digitonin or DDM, and use epitope tags (HA, FLAG) for improved antibody detection.

  • Phase-dependent expression: YMC2 expression varies dramatically between growth phases.
    Solution: Standardize cell collection timing by monitoring OD600 precisely (0.5-1.0 for exponential, >2.0 for stationary) and maintain consistent culture conditions with 15-16h overnight log-phase growth to ensure mitochondrial uniformity.

  • Reference gene selection problems: Inappropriate reference genes can lead to misinterpretation.
    Solution: Validate multiple reference genes (ACT1, TAF10, TFC1) under your specific experimental conditions before normalizing YMC2 expression data.

  • Carbon source effects: Media composition significantly impacts YMC2 expression.
    Solution: When comparing conditions, maintain consistent media formulations except for the variable under study, and include appropriate controls for each carbon source .

What methods are recommended for analyzing YMC2 protein-protein interactions?

To effectively analyze YMC2 protein-protein interactions, researchers should employ complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged YMC2 (HA or FLAG) in yeast

    • Solubilize mitochondria using mild detergents (digitonin 1%)

    • Perform IP with tag-specific antibodies

    • Identify interaction partners by mass spectrometry

    • Validate specific interactions with reverse Co-IP

  • Proximity labeling:

    • Generate YMC2-BirA* fusion proteins

    • Provide biotin to cells (50 μM, 1h)

    • Isolate biotinylated proteins using streptavidin

    • Identify proximal proteins by mass spectrometry

  • Yeast two-hybrid (Y2H) screening:

    • Use split-ubiquitin Y2H system designed for membrane proteins

    • Screen against mitochondrial protein libraries

    • Validate hits using the methods above

  • Fluorescence resonance energy transfer (FRET):

    • Generate YMC2-CFP and candidate interactor-YFP fusions

    • Measure FRET signals in live cells

    • Analyze data using acceptor photobleaching to confirm interactions

  • Cross-linking mass spectrometry:

    • Treat isolated mitochondria with membrane-permeable crosslinkers

    • Digest and analyze by MS/MS

    • Identify crosslinked peptides to map interaction interfaces

Recent studies using these approaches have revealed interactions between mitochondrial carrier proteins and components of both the protein import machinery and metabolic enzymes, providing insight into how these transporters are integrated into larger functional networks .

What experimental design considerations are critical when studying YMC2 knockout phenotypes?

When studying YMC2 knockout phenotypes, careful experimental design is essential to obtain reliable and biologically relevant results:

Experimental ParameterCritical ConsiderationsMethodological Solution
Growth media selectionCarbon source dramatically affects phenotype expressionTest multiple carbon sources (glucose, ethanol, glycerol) in parallel experiments
Growth phase monitoringPhenotypes may only manifest at specific growth phasesMonitor growth curves and sample at precise points (OD600 = 0.5-1.0 for exponential, >2.0 for stationary)
Strain backgroundDifferent S. cerevisiae backgrounds show variable phenotypesUse isogenic strains and include multiple backgrounds for validation
Complementation controlsPhenotypes must be proven to result from YMC2 deletionInclude wild-type YMC2 complementation and test multiple independent knockout clones
Experimental durationShort-term vs. long-term effects may differ substantiallyPerform both acute (hours) and chronic (days) assessments
Compensatory mechanismsCtp1 upregulation masks YMC2 deletion effectsConsider double knockouts (ΔYHM2ΔCTP1) or regulated expression systems
Stress conditionsYMC2 phenotypes often manifest only under stressTest growth under oxidative stress (H2O2), osmotic stress, and temperature stress

Research has shown that ΔYHM2 strains exhibit a significant increase (3-fold) in Ctp1 mRNA levels during exponential growth compared to wild-type strains, indicating strong compensatory mechanisms that must be accounted for in experimental design. Additionally, growth experiments should include serial dilution assays on solid media to detect subtle growth defects that might be missed in liquid culture .

How might YMC2 function be explored in the context of mitochondrial dynamics and quality control?

Exploring YMC2 in relation to mitochondrial dynamics presents exciting research opportunities:

  • MDC formation mechanism: Investigate whether YMC2 is actively sorted into mitochondrial-derived compartments (MDCs) during protein quality control. This can be accomplished by combining fluorescently-tagged YMC2 with Tom70 (an MDC marker) and monitoring colocalization during rapamycin treatment, which induces MDC formation. Quantification of MDCs should involve super-resolution confocal fluorescence microscopy with 100 cells per experiment across three biological replicates .

  • Fission/fusion dependence: Examine how mitochondrial dynamics machinery affects YMC2 distribution and function by analyzing YMC2 localization in fission/fusion mutants (Δdnm1, Δfis1, Δfzo1). Research should measure transport activity in these backgrounds to determine if dynamic processes influence carrier protein function.

  • Age-dependent regulation: Investigate whether YMC2 abundance or activity changes during cellular aging by isolating aged yeast cells (through mother-daughter separation) and comparing YMC2 expression and function with young cells.

  • Stress-response integration: Determine how YMC2 responds to mitochondrial stressors that trigger quality control pathways. This approach should include monitoring YMC2 levels during oxidative stress, protein misfolding stress, and membrane potential collapse.

  • Interdependence with ERMES: Explore potential functional connections between YMC2 and the endoplasmic reticulum-mitochondria encounter structure, which facilitates interorganellar communication at membrane contact sites .

What novel methods could advance our understanding of YMC2 transport kinetics and substrate specificity?

Advancing our understanding of YMC2 transport properties requires innovative methodological approaches:

  • Nanodisc reconstitution: Incorporate purified YMC2 into nanodiscs (nanoscale lipid bilayers stabilized by scaffold proteins) to study transport in a more native-like membrane environment than traditional liposomes. This approach maintains protein stability while allowing precise control of lipid composition.

  • Single-molecule FRET: Develop YMC2 constructs with strategically placed fluorophores to monitor conformational changes during transport cycles using single-molecule FRET. This would provide unprecedented insights into transport mechanisms and substrate-induced conformational dynamics.

  • Microfluidic transport assays: Design microfluidic platforms with immobilized proteoliposomes containing YMC2 for real-time monitoring of transport with rapid solution exchange capabilities, enabling more precise kinetic measurements.

  • Metabolic flux analysis: Combine 13C-labeled metabolites with mass spectrometry to track citrate and α-ketoglutarate flux in wild-type versus ΔYHM2 strains, providing in vivo assessment of transport activity under various conditions.

  • Cryo-EM structural studies: Pursue high-resolution structures of YMC2 in different conformational states (substrate-bound, apo) using single-particle cryo-electron microscopy to correlate structure with function.

  • Computational substrate docking: Employ molecular dynamics simulations with homology models of YMC2 to predict substrate binding sites and transport pathways, guiding subsequent mutagenesis studies .

How can systems biology approaches enhance our understanding of YMC2 in cellular metabolism?

Systems biology approaches offer powerful frameworks for integrating YMC2 function into broader metabolic contexts:

  • Metabolomic profiling: Compare metabolite profiles between wild-type and ΔYHM2 strains under various growth conditions using LC-MS/MS techniques. Focus particularly on TCA cycle intermediates, NADPH/NADP+ ratios, and antioxidant molecules. Research has shown significant metabolic reprogramming during the shift from fermentative to respiratory metabolism, with YMC2 expression increasing 523% during this transition .

  • Flux balance analysis: Develop computational models incorporating YMC2-mediated transport to predict metabolic outcomes under different conditions. Validate model predictions with experimental measurements of growth rates and metabolite concentrations.

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data from wild-type and YMC2 mutant strains to construct comprehensive regulatory networks. This approach can reveal unexpected connections between YMC2 and seemingly unrelated cellular processes.

  • Synthetic genetic interaction networks: Perform genome-wide synthetic genetic array (SGA) analysis with ΔYHM2 strains to identify genetic interactions. Cluster these interactions to position YMC2 within functional modules.

  • Dynamic metabolic modeling: Develop time-resolved models that capture how YMC2-mediated transport changes during metabolic shifts, such as the diauxic shift from fermentation to respiration, where expression studies show dramatic upregulation of YMC2.

  • Comparative systems analysis: Extend studies across multiple yeast species to understand how YMC2 function has evolved in different metabolic contexts .

What interdisciplinary approaches could enhance YMC2 research?

Advancing YMC2 research through interdisciplinary collaboration offers unique insights:

  • Structural biology and biochemistry: Combine crystallography or cryo-EM with transport assays to correlate structure-function relationships. This approach has successfully elucidated mechanisms for other mitochondrial carriers by expressing genes in E. coli, reconstituting purified proteins into liposomes, and testing transport activity with selected substrates .

  • Computational biology and biophysics: Use molecular dynamics simulations to model substrate translocation through YMC2, identifying critical residues that can be validated through site-directed mutagenesis and functional assays.

  • Synthetic biology and metabolic engineering: Redesign YMC2 transport properties to create yeast strains with enhanced metabolic capabilities for biotechnological applications. Research indicates that YMC2 expression significantly impacts metabolic adaptation strategies, with mRNA levels increasing 523% during the shift to respiratory metabolism .

  • Systems biology and mathematical modeling: Integrate YMC2 transport kinetics into genome-scale metabolic models to predict systemic effects of altered YMC2 activity under various conditions.

  • Cell biology and advanced imaging: Apply super-resolution microscopy techniques like ZEISS LSM800 with Airyscan to visualize YMC2 distribution within mitochondrial subdomains and potential colocalization with protein quality control machinery .

  • Evolutionary biology: Compare YMC2 function across fungal species to understand its evolutionary history and specialized adaptations.

Each of these collaborative approaches provides complementary insights that would be difficult to achieve within a single discipline.

How can researchers effectively study the interplay between YMC2 and other mitochondrial carrier proteins?

To effectively study the interplay between YMC2 and other mitochondrial carriers, particularly Ctp1, researchers should implement these methodological approaches:

These approaches should be implemented across multiple growth conditions (glucose vs. ethanol media) and growth phases (exponential vs. stationary) to capture the dynamic relationship between these transporters .

What standardized protocols should be established for comparing YMC2 research across different laboratories?

To enhance reproducibility and facilitate cross-laboratory comparison of YMC2 research, the following standardized protocols are recommended:

Protocol ComponentStandardization RecommendationTechnical Details
Strain backgroundUse BY4741/BY4742 as primary reference strainsSecondary validation in W303 or S288C backgrounds
Growth conditionsPrecisely defined media compositionYPAD (1% yeast extract, 2% peptone, 0.005% adenine, 2% glucose) or synthetic defined media with complete supplement mixture
Growth monitoringStandardized OD600 measurementsExponential phase: OD600 = 0.5-1.0; Stationary phase: OD600 > 2.0 after 48h
RNA extractionHot phenol method with DNase treatmentInclude technical replicates and validated reference genes (ACT1, TAF10)
qPCR analysisMIQE-compliant protocolsPrimer sequences targeting YMC2: Forward 5'-XXXXX-3', Reverse 5'-XXXXX-3'
Protein extractionOptimized mitochondrial isolationDifferential centrifugation followed by sucrose gradient purification
Western blottingStandardized detection antibodiesUse epitope tags (HA, FLAG) when specific antibodies are unavailable
Transport assaysDefined liposome composition3:1 phosphatidylcholine:cardiolipin, protein:lipid ratio 1:100
Data reportingComprehensive metadata inclusionPrecise reporting of strain genotypes, growth conditions, cell densities, and raw data availability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.