Recombinant Saccharomyces cerevisiae Cell division control protein 1 (CDC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. However, if you require a specific format, please specify this during order placement. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
CDC1; DSR1; ESP2; YDR182W; YD9395.16; Cell division control protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
CDC1
Target Protein Sequence
MVYRNRSKSVLSTHSKKSDDKAHYKSRSKKKSKSRSKKRLRIYWRYISIVWILWLGLISY YESVVVKRAMKKCQWSTWEDWPEGAESHRVGLFADPQIMDEYSYPGRPQIVNYFTRVIVD HYHRRNWKYVQYYLDPDSNFFLGDLFDGGRNWDDKQWIKEYTRFNQIFPKKPLRRTVMSL PGNHDIGFGDTVVESSLQRFSSYFGETSSSLDAGNHTFVLLDTISLSDKTNPNVSRVPRQ FLDNFAMGSHPLPRILLTHVPLWRDPEQQTCGQLRESKEPFPIQKGHQYQTVIENDISQE ILTKIQPEILFSGDDHDHCQISHSYPFQGKTKNAQEITVKSCAMNMGISRPAIQLLSLYN PSDLTMVNAGGEYASKTYQTELCYMPDPYKAIRMYLWGLLFSAAFIAYMHFFPKSFNNRV ATIMNRVFTRPDGNTSDLPLPTSISKSKSKKSLTHSKYAVNDTRSIKQFLVNAIVLFVSV MPIFIYFYTVV
Uniprot No.

Target Background

Function

Probable metallophosphoesterase potentially involved in the recombinational repair of double-strand DNA breaks.

Gene References Into Functions
  1. Cdc1 removes the ethanolamine phosphate from the first mannose residue of glycosylphosphatidylinositol (GPI) anchors, facilitating the integration of GPI-anchored proteins into the yeast cell wall. PMID: 25165136
  2. Cdc1p is an endoplasmic reticulum-localized transmembrane protein with a putative phosphoesterase domain facing the lumen. cdc1 mutant cells accumulate an unidentified phospholipid, suggesting a potential role for Cdc1p as a lipid phosphatase. PMID: 18332110
Database Links

KEGG: sce:YDR182W

STRING: 4932.YDR182W

Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Cell Division Control protein 1 in yeast cell division?

Cell Division Control protein 1 in Saccharomyces cerevisiae is involved in the regulation of cellular processes during mitotic division. The protein functions within a complex network of cell cycle regulators that orchestrate proper chromosome segregation and cell division. Similar to other cell cycle proteins in yeast, CDC1 likely exhibits cell cycle-specific localization patterns, potentially forming structures between dividing nuclei during specific phases of cell division, comparable to how the Fin1 protein forms filaments between spindle pole bodies in large-budded cells .

How does CDC1 expression change throughout the cell cycle?

Expression of CDC1, like many cell cycle-specific proteins in Saccharomyces cerevisiae, is likely regulated temporally. Similar proteins such as Fin1 show specific expression patterns, with significant upregulation during the G2-to-M transition . This temporal regulation ensures that these proteins are present at the precise moments when they are required for proper cell division. Researchers investigating CDC1 should consider analyzing its expression using techniques such as synchronization of yeast cultures followed by time-course RNA and protein level measurements.

What structural motifs characterize CDC1 protein?

While specific structural information about CDC1 must be experimentally determined, proteins involved in yeast cell division often contain distinctive structural features that enable their functions. For instance, the yeast Fin1 protein contains basic regions and coiled-coil motifs that facilitate filament formation . CDC1 may similarly contain functional domains such as:

  • Potential coiled-coil regions mediating protein-protein interactions

  • Phosphorylation sites for cell cycle-dependent regulation

  • Localization sequences directing the protein to specific cellular compartments

What experimental methods are most effective for studying CDC1 localization?

The subcellular localization of cell division proteins provides crucial insights into their functions. To study CDC1 localization:

  • Fluorescent protein tagging: Create fusion proteins with GFP or CFP tags to track CDC1 localization throughout the cell cycle, similar to approaches used with Fin1. This enables visualization of dynamic localization patterns in living cells .

  • Immunofluorescence microscopy: Use specific antibodies to detect endogenous CDC1 at different cell cycle stages, particularly in synchronized cultures.

  • Co-localization studies: Determine whether CDC1 associates with known structures such as spindle pole bodies, kinetochores, or specific filaments during cell division by simultaneously tagging reference proteins like Tub1 .

The optimal approach combines these techniques to confirm localization patterns and minimize artifacts caused by any single method.

How can phosphoregulation of CDC1 be effectively studied?

Phosphorylation is a critical regulatory mechanism for many cell division proteins in yeast. For example, CDK phosphorylation regulates CDH1 binding to the APC/C complex . To investigate CDC1 phosphoregulation:

  • Phosphosite mapping: Use mass spectrometry to identify phosphorylated residues on CDC1.

  • Phosphomutant analysis: Create non-phosphorylatable (Ser/Thr to Ala) and phosphomimetic (Ser/Thr to Asp/Glu) mutants to determine how phosphorylation affects CDC1 function.

  • Kinase identification: Perform in vitro kinase assays with candidate cell cycle kinases (CDKs, Polo-like kinases, etc.) to identify which enzymes phosphorylate CDC1.

  • Phosphorylation-dependent interactions: Use co-immunoprecipitation studies comparing wild-type and phosphomutants to identify interactions that depend on phosphorylation state.

What are the best approaches for identifying CDC1 interaction partners?

Understanding the protein interaction network of CDC1 is essential for elucidating its functions. Recommended methodologies include:

  • Yeast two-hybrid screening: This approach has successfully identified interaction partners for various cell cycle proteins, including Fin1, which was found to interact with Reb1p, Fir1p, and Wss1p .

  • Affinity purification coupled with mass spectrometry (AP-MS): Purify TAP-tagged CDC1 from yeast cultures and identify co-purifying proteins by mass spectrometry, similar to approaches used for APC/C purification .

  • Proximity-based labeling: Use BioID or APEX2 fusion proteins to identify proximal proteins in living cells.

Each method has strengths and limitations, so a combination approach provides the most comprehensive and reliable results.

MethodAdvantagesLimitationsBest For
Yeast Two-HybridDetects direct interactions; High throughputHigh false-positive rateInitial screening
AP-MSIdentifies complexes; Preserves native conditionsMay miss transient interactionsStable complex identification
Proximity LabelingCaptures transient interactions; In vivoSpatial resolution limitationsIdentifying neighborhood proteins

What expression systems yield the highest quality recombinant CDC1?

For obtaining high-quality recombinant CDC1 for structural and biochemical studies, researchers should consider:

  • Bacterial expression: E. coli systems provide high yields but may lack proper post-translational modifications important for CDC1 function.

  • Yeast expression: Homologous expression in Saccharomyces cerevisiae preserves native folding and modifications but may yield lower quantities.

  • Insect cell expression: Baculovirus expression systems offer a compromise between yield and eukaryotic post-translational modifications, similar to systems successfully used for APC/C expression .

For structural studies requiring high quantities of properly folded protein, the baculovirus insect cell system has proven particularly effective for yeast cell cycle proteins, as demonstrated in the case of APC/C .

What purification strategies maximize CDC1 activity retention?

Preserving the functional activity of CDC1 during purification is critical for subsequent biochemical and structural analyses:

  • Affinity tags: Incorporate removable affinity tags (His6, GST, or TAP) for initial capture, but ensure tag removal can be performed under gentle conditions.

  • Buffer optimization: Determine buffer conditions (pH, salt concentration, reducing agents) that maintain CDC1 stability using thermal shift assays.

  • Size exclusion chromatography: As a final purification step, this separates monomeric from aggregated protein and allows buffer exchange into storage conditions.

  • Activity preservation: Include protease inhibitors and phosphatase inhibitors throughout purification if phosphorylation states are important for CDC1 function.

When planning purification, consider that some cell division proteins from yeast, like Fin1, can self-assemble into filamentous structures under certain conditions , which may affect purification strategies.

What techniques are most informative for determining CDC1 structure?

Understanding the structure of CDC1 provides insights into its function and regulation. Key techniques include:

  • Cryo-electron microscopy (cryo-EM): This technique has successfully revealed detailed structures of complex cell cycle proteins like the APC/C , showing both conservation and differences between yeast and human proteins.

  • X-ray crystallography: For higher resolution analysis of specific domains.

  • Atomic force microscopy (AFM): Useful for examining self-assembly properties and filament formation, as demonstrated with Fin1 protein .

  • Small-angle X-ray scattering (SAXS): Provides information about protein shape and conformational changes in solution.

The choice of method depends on the specific questions being addressed. For instance, cryo-EM has proven particularly valuable for large complexes like the APC/C, revealing important differences between yeast and human versions .

How can protein dynamics and conformational changes be assessed?

Cell division proteins often undergo conformational changes during the cell cycle. To study CDC1 dynamics:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions that undergo conformational changes or become protected upon binding partners.

  • Single-molecule FRET: Monitors distance changes between labeled domains in real-time.

  • NMR spectroscopy: For smaller domains, provides atomic-level information about flexibility and dynamics.

These approaches can reveal how CDC1 might change conformation in response to post-translational modifications or binding partners during different phases of the cell cycle.

What are the most informative phenotypic assays for CDC1 mutants?

Phenotypic characterization of CDC1 mutants provides insights into its cellular functions:

  • Growth and viability assays: Test mutant growth under various conditions (temperature, osmotic stress, cell cycle inhibitors).

  • Cell cycle progression analysis: Use flow cytometry to determine if CDC1 mutations affect specific cell cycle phases.

  • Microscopic examination: Analyze morphological abnormalities in dividing cells, similar to observations that overexpression of Fin1p resulted in abnormal cell morphology .

  • Genetic interaction screens: Synthetic lethal/sick screens can identify functionally related genes.

When designing mutants, consider that like Fin1, CDC1 may be non-essential under standard laboratory conditions but could become critical under specific circumstances or in certain genetic backgrounds .

How can contradictory data about CDC1 function be reconciled?

Research on complex proteins often produces seemingly contradictory results. To reconcile such data:

  • Strain background effects: Different yeast strains may show different phenotypes for the same mutation due to genetic background effects.

  • Condition-specific functions: Test across a range of conditions, as protein function may only be revealed under specific circumstances.

  • Redundant pathways: Identify potential compensatory mechanisms that may mask phenotypes in single mutants.

  • Method limitations: Recognize that different experimental approaches (in vivo vs. in vitro) can yield different results due to their inherent limitations.

A comprehensive analysis requires integrating data from multiple approaches and carefully controlling experimental variables.

How is CDC1 regulated throughout the cell cycle?

Cell cycle proteins in yeast are tightly regulated through multiple mechanisms:

  • Transcriptional regulation: Similar to Fin1, which shows cell cycle-specific expression with upregulation during G2-to-M transition .

  • Post-translational modifications: Phosphorylation likely plays a key role, as seen with other cell cycle proteins like CDH1, where CDK phosphorylation inhibits its binding to APC/C .

  • Protein localization: Dynamic changes in subcellular localization, as observed with Fin1 protein that forms filaments between spindle pole bodies only during specific cell cycle stages .

  • Protein-protein interactions: Cell cycle-specific interactions that modulate protein function or localization.

Understanding these regulatory mechanisms requires integrating data from transcript analysis, phosphoproteomics, and localization studies throughout the cell cycle.

What methods best capture CDC1 dynamics in live cells?

To study the dynamic behavior of CDC1 during cell division:

  • Live-cell imaging with fluorescent protein fusions: Track CDC1-GFP localization in real-time through the cell cycle, similar to approaches used with Fin1 .

  • Photoactivatable or photoconvertible tags: Use proteins like mEOS or Dendra2 to pulse-label and track specific populations of CDC1.

  • FRAP (Fluorescence Recovery After Photobleaching): Determine mobility and turnover rates of CDC1 at specific cellular locations.

  • Correlative light and electron microscopy (CLEM): Combine live-cell imaging with high-resolution ultrastructural analysis.

These approaches provide complementary information about the dynamic behavior of CDC1 during cell division, helping to establish the timing and location of its activities.

How conserved is CDC1 function across different yeast species and higher eukaryotes?

Comparative analysis provides evolutionary insights into protein function:

  • Sequence conservation analysis: Compare CDC1 sequences across fungal species and identify conserved domains that may indicate functional importance.

  • Complementation studies: Test whether CDC1 from other species can rescue defects in S. cerevisiae CDC1 mutants.

  • Structural comparison: Compare the structure of CDC1 with homologs from other species, noting that structural conservation often exceeds sequence conservation.

As seen with APC/C, significant structural similarities may exist between yeast and human proteins, alongside important functional differences in regulation and activation mechanisms .

What can be learned from comparisons with other cell division proteins?

Comparative analysis with functionally related proteins provides context for understanding CDC1:

  • Functional redundancy: Identify proteins that may compensate for CDC1 function, explaining why some cell division proteins like Fin1 are non-essential despite their important roles .

  • Evolutionary specialization: Determine whether CDC1 has evolved specialized functions in S. cerevisiae compared to its homologs.

  • Regulatory patterns: Compare regulation mechanisms across different cell division proteins to identify common principles of cell cycle control.

The search results show that while human and S. cerevisiae APC/C architectures are generally similar, there are significant differences in regulatory mechanisms , suggesting that each protein should be carefully studied within its specific context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.